Previous Article | Next Article 
Infection and Immunity, December 1999, p. 6550-6557, Vol. 67, No. 12
0019-9567/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Cytotoxic Necrotizing Factor Type 2 Produced by
Pathogenic Escherichia coli Deamidates a Gln Residue in the
Conserved G-3 Domain of the Rho Family and Preferentially Inhibits the
GTPase Activity of RhoA and Rac1
Motoyuki
Sugai,1,*
Kiyotaka
Hatazaki,1
Akira
Mogami,1,
Hiroyuki
Ohta,2,§
Sylvie Y.
Pérès,3
Fredéric
Hérault,3
Yasuhiko
Horiguchi,4
Minako
Masuda,4
Yoko
Ueno,1
Hitoshi
Komatsuzawa,1
Hidekazu
Suginaka,1 and
Eric
Oswald3
Department of Microbiology, Hiroshima
University School of Dentistry, Hiroshima
734-8553,1 Department of Microbiology,
Okayama University School of Dentistry, Okayama
700-8525,2 and Department of
Bacterial Toxinology, Research Institute for Microbial Diseases, Osaka
University, Suita, Osaka 565-0871,4 Japan,
and UMR de Microbiologie Moléculaire, Institut
National de la Recherche Agronomique, Ecole National
Vétérinaire de Toulouse, 31076 Toulouse Cedex,
France3
Received 8 June 1999/Returned for modification 13 August
1999/Accepted 10 September 1999
 |
ABSTRACT |
Cytotoxic necrotizing factor types 1 and 2 (CNF1 and -2) produced
by pathogenic Escherichia coli strains have 90% conserved residues over 1,014-amino-acid sequences. Both CNFs are able to provoke
a remarkable increase in F-actin structures in cultured cells and
covalently modify the RhoA small GTPases. In this study, we
demonstrated that CNF2 reduced RhoA GTPase activity in the presence and
absence of P122RhoGAP. Subsequently, peptide mapping and
amino acid sequencing of CNF2-modified FLAG-RhoA produced in E. coli revealed that CNF2 deamidates Q63 of RhoA-like CNF1. In
vitro incubation of the C-terminal domain of CNF2 with FLAG-RhoA
resulted also in deamidation of the FLAG-RhoA, suggesting that this
region contains the enzymatic domain of CNF2. An oligopeptide antibody
(anti-E63) which specifically recognized the altered G-3 domain of the
Rho family reacted with glutathione S-transferase
(GST)-RhoA and GST-Rac1 but not with GST-Cdc42 when coexpressed with
CNF2. In addition, CNF2 selectively induced accumulation of GTP form of
FLAG-RhoA and FLAG-Rac1 but not of FLAG-Cdc42 in Cos-7 cells. Taken
together, these results indicate that CNF2 preferentially deamidates
RhoA Q63 and Rac1 Q61 and constitutively activates these small GTPases
in cultured cells. In contrast, anti-E63 reacted with GST-RhoA and
GST-Cdc42 but not with GST-Rac1 when coexpressed with CNF1. These
results indicate that CNF2 and CNF1 share the same catalytic activity
but have distinct substrate specificities, which may reflect their
differences in toxic activity in vivo.
 |
INTRODUCTION |
Several bacterial toxins and enzymes
have been shown to modify eukaryotic small GTPases. Most of them were
found to target members of the Rho GTPase family. The Rho GTPase family
consists of the Rho, Rac, Cdc42, and G25K subfamilies in humans
(3, 35). Among them, the Rho GTPase subfamily, including
RhoA, RhoB, and RhoC, controls the formation of focal adhesions and
actin stress fibers in cells (42, 43). These GTPases are
either in a GDP-bound inactive form or in a GTP-bound active form
(2, 35). The GDP-bound form is converted to the GTP-bound
form by a GDP-GTP exchange reaction, which is regulated by GDP-GTP
exchange protein (GEP) (19, 21, 26, 27, 33). The GTP-bound
form is converted to the GDP-bound form by a GTPase reaction, which is
regulated by GTPase-activating protein (GAP) (23, 30, 48).
The biochemistry involved in the toxin-mediated modification of Rho
GTPases includes ADP-ribosylation, glucosylation, and N-acetylglucosaminylation, all of which result in
deactivation of Rho GTPases. By contrast, the dermonecrotic toxin (DNT)
of Bordetella bronchiseptica (24) and cytotoxic
necrotizing factor types 1 and 2 (CNF1 and -2), produced by certain
pathogenic Escherichia coli strains, activate Rho GTPase
(16, 17, 38).
CNF1 and CNF2 are 110- to 115-kDa monomeric toxins (6, 10,
36) sharing 90% conserved residues over 1,014 amino acids (14, 38). CNF1 is encoded by the chromosome (14),
whereas a transmissible plasmid called pVir codes for CNF2
(37). CNF1 and CNF2 are highly lethal in mice and share the
ability to induce multinucleation in different cell lines and necrosis
in the rabbit skin (7, 8). However, CNF1 is more potent than
CNF2 in inducing multinucleation but less necrotic in the rabbit skin
test and mouse footpad (8). In addition, CNF2 was found to
migrate faster than CNF1 in sodium dodecyl sulfate-polyacrylamide gel
electrophoresis (SDS-PAGE) (36). The involvement of the Rho
signaling pathway in CNF toxicity was first suggested by the remarkable
reorganization of the F-actin cytoskeleton into stress fibers after
treatment of cultivated cells with CNF1 or CNF2 (15, 38).
The Rho GTPase isolated from CNF-treated cells was then found to
migrate more slowly in SDS-PAGE, suggesting that Rho is covalently
modified by CNF (16, 38). Indeed, CNF1 was shown to directly
deamidate Rho at Q63, an amino acid present in the G-3 domain conserved in small GTPases and known to be essential for GTPase activity (18, 45). The deamidated Rho showed a marked decrease in
intrinsic GTPase activity, and thus the Rho stayed in a constitutively
active form. In addition, CNF1 was shown to decrease intrinsic GTPase activity of another member of the Rho GTPase family, Cdc42, suggesting that CNF1 modifies other members of the Rho family (45).
The apparent differences between CNF1 and CNF2 in toxic activities and
electrophoretic properties led us to investigate the nature of
biochemical modification of RhoA after treatment by CNF2. We report
here that CNF2 also deamidates Rho at Q63 and abolishes GTPase activity
in the presence or absence of Rho GAP. Moreover, Western blotting
analysis with anti-E63, an oligopeptide antibody specifically
recognizing DTAGEEDYDRLRPLS, the G-3 domain of Rho family
with altered E63 (underlined), revealed that, in vitro, CNF2
preferentially deamidates RhoA and Rac1 and has low to no enzymatic
activity on Cdc42. This was confirmed in Cos-7 cells, where CNF2
selectively induced accumulation of the GTP-bound form of RhoA and Rac1.
Taken together, our results clearly indicate that CNF2 and CNF1 share
the same catalytic activity and deamidation of members of Rho family
but that their substrate specificities are distinct.
 |
MATERIALS AND METHODS |
Materials.
CNF2 was purified to homogeneity from an E. coli C600 (pEOSW30) (38) homogenate by three column
chromatography steps with DEAE Toyopearl 650M, TSK-gel Phenyl 5PW, and
TSK-gel HA1000 columns (Tosoh, Tokyo, Japan). The CNF2 activity was
assayed as described earlier (9). The detailed purification
procedure will be described elsewhere. Briefly, the supernatant of an
E. coli cell homogenate prepared by use of a French press
was dialyzed against 20 mM Tris-Cl (pH 8.5). The dialyzed sample was
loaded into DEAE Toyopearl 650M equilibrated with the same buffer and
was eluted with a linear gradient from 0 to 0.5 M NaCl in 20 mM Tris-Cl
(pH 8.5). The active fractions were pooled and dialyzed against 50 mM
phosphate buffer containing 1.5 M NaCl (pH 7.0) and then loaded into
TSK-gel Phenyl 5PW (7.5 by 75 mm). The sample was eluted with a linear
gradient from 1.5 to 0 M NaCl in 50 mM phosphate buffer (pH 7.0). The
active fractions were pooled and dialyzed against 10 mM phosphate
buffer (pH 7.0). The dialyzed sample was passed through a
hydroxyapatite column, TSK-gel HA1000 (7.5 by 75 mm) equilibrated with
10 mM phosphate buffer (pH 7.0). The unbound fraction was collected and
used as purified CNF2. The purity of the CNF2 was checked by SDS-PAGE,
followed by Coomassie brilliant blue staining.
[
-32P]GTP, [
-32P]GTP,
[
-32P]NAD, and 32Pi were
obtained from DuPont NEN. Guanine nucleotides were from Sigma Chemical
Co., St. Louis, Mo. The plasmids used in this study are listed in Table
1. pGEX-5X-3-Cdc42Hs,
pGEX2T-P122RhoGAP, and pGST-RhoA were gifts from Akira
Kikuchi (Department of Biochemistry, Hiroshima University School of
Medicine), Yoshimi Homma (Institute for Signal Transduction, Fukushima
Medical College), and Hiroshi Maruta (Ludwig Institute for Cancer
Research), respectively. Rabbit immunoglobulin G generated against
synthetic peptide DTAGEEDYDRLRPLS, which corresponds to the
conserved region of the GTPase domain (the underlined amino acid [E]
was altered from Q) (anti-E63), was prepared as described earlier
(25). Swiss 3T3 and Cos-7 cells were cultured as described
previously (38). Swiss 3T3 cells were washed three times
with cold phosphate-buffered saline (PBS), pooled by scraping, pelleted
by centrifugation, and homogenized as described by Oswald et al.
(37).
Preparation of small GTPase, P122RhoGAP, and CNF.
E. coli C600(pGST-RhoA) and E. coli
BL21(DE3)(pFLAG-RhoA) or BL21(D3)(pFLAG-RhoA63E) were
prepared as described earlier (25). E. coli
harboring a vector containing the small GTPase gene was transformed
with either pEOSW30, which encodes CNF2; pSPEO1/2 (37),
which encodes CNF1; or vector alone, pK184 (38). To
purify glutathione S-transferase (GST) fused to small G
protein from E. coli, transformed E. coli was
grown in Luria-Bertani broth at 37°C to an absorbance of 0.8 (optical
density at 660 nm). Then
isopropyl-
-D-thiogalactopyranoside was added at a final
concentration of 40 µM, and further incubation was carried out for
3 h. GST fused to P122RhoGAP was produced in E. coli as described above except that E. coli was grown
at 25°C. The recombinant RhoA, Cdc42, Rac1, and
P122RhoGAP expressed as GST fusion proteins were purified
by using glutathione-Sepharose beads according to the manufacturer's
instructions. The recombinant RhoA and RhoA E63 expressed as N-terminal
FLAG-tagged proteins were purified by using anti-FLAG M2 affinity gel
(Sigma) according to the manufacturer's instructions. Some experiments
used histidine-tagged (His-tag) fusion proteins containing full-length
CNF2, N-terminal CNF2 fragments, or C-terminal CNF2 fragments. The
pROEX-1 vector (Life Technologies, Inc.) was used to construct and
express these fusion proteins. When necessary, an NdeI
restriction site was introduced upstream the ATG by PCR. The constructs
were pSPEO3, encoding His-tag fused with the N-terminal region of CNF2
(amino acids 1 to 522) (His-tag-CNF2 [N-term]); pSPE01, encoding
His-tag fused with the C-terminal region of CNF2 (amino acids 450 to
1014) (His-tag-CNF2 [C-term]); and pSPE6, encoding His-tag fused with full-length CNF2 (amino acids 1 to 1014) (His-tag-CNF2 [full]). The
predicted molecular masses of the fusion proteins were 59.8, 66.3, and
117.5 kDa, respectively. The recombinant His-tagged proteins were
purified by using TSK-gel AF-chelating Toyopearl 650M (Tosoh) and
Ni2+ as the metal ion as described previously
(51). All purification procedures were performed at 4°C.
Enzymatic digestions and peptide mapping.
The purified
FLAG-RhoA (1 mg) was digested with endopeptidase Lys-C from
Achromobacter lyticus (Wako Pure Chemical Industries, Ltd.,
Osaka, Japan). The proteolytic digestion was carried out as described
elsewhere. Products from Lys-C were separated by reversed-phase
high-performance liquid chromatography (HPLC) by using a
C18 column (2.0 by 150 mm; Nomura Chemical Co., Ltd., Seto,
Japan) attached to a Waters 600E HPLC system. The peptides were eluted
at a flow rate of 0.15 ml/min with a multistep, linear gradient of 70%
solvent A (0.06% trifluoroacetic acid in water) and 30% solvent B
(0.054% trifluoroacetic acid in acetonitrile-water [4:1, vol/vol])
to 40% solvent A-60% solvent B over 85 min, followed by a linear
gradient of 40% solvent A-60% solvent B to 20% solvent A-60%
solvent B over 10 min. The A210 was monitored
with a Waters 486 UV detector. Some isolated peptides were further
digested with trypsin in 0.1 M NH4HCO3-2 M
urea at 37°C for 24 h, and the products were separated by the
reversed-phase HPLC system. The peptides were eluted at a flow rate of
0.15 ml/min with a multistep linear gradient from 98% solvent A and
2% solvent B to 100% solvent B by using the following program: 2 to
37% solvent B for 75 min, 37 to 75% solvent B for 10 min, and 75 to
100% solvent B for 5 min.
N-terminal amino acid sequencing of peptides.
Peptides
isolated by reversed-phase HPLC were spotted directly on a
polyvinylidene difluoride membrane (ABI ProBlot). Immobilized peptides
were subjected to automated Edman degradation on an ABI 476A protein
sequencer with standard blot sequencing cycles.
MS analysis of peptides.
Peptide fractions resulting from
the reversed-phase HPLC were analyzed by electrospray ionization-mass
spectrometry (ESI-MS) on a TSQ-700 triple-sector quadrupole mass
spectrometer (Finnigan-MAT, San Jose, Calif.) equipped with an ESI
source operating at atmospheric pressure. The molecular weights of
peptides were determined by mathematically transforming the raw ESI-MS
spectrum of each peptide with the BIOMASS Deconvolution program
(Finnigan-MAT).
[35S]GTP
S-binding assay.
Binding of
35S-labeled guanosine
5'-3(O-thio)triphospate with sulfur linked to the
phosphate group at the third position (GTP
S) to GST-RhoA was
determined by using the nitrocellulose method (49). Purified
GST-RhoA was incubated at 30°C in 100 µl of a reaction mixture
containing 50 mM Tris-Cl at pH 7.5, 1 mM dithiothreitol (DTT), 5 mM
MgCl2, and various concentration of
[35S]GTP
S (1,000 to 2,000 cpm/pmol). The reaction was
stopped by the addition of 4.75 ml of ice-cold 20 mM Tris-Cl (pH 7.5),
1 mM DTT, and 5 mM MgCl2, followed by rapid filtration on
nitrocellulose filters. Filters were washed three times with the same
ice-cold buffer. Thereafter, the filters were dissolved in 4 ml of
Scintisol EX-H (Dojin Chemical Institute, Kumamoto, Japan), and the
radioactivity was measured. The experiments were carried out in
triplicate. The Kd values were determined as
described elsewhere (22).
GDP dissociation assay.
To determine the GDP dissociation
constant (K
1), GST-RhoA in
[3H]GDP-bound form (100 nM) was incubated in the buffer
containing 50 mM Tris-Cl (pH 7.5), 1 mM DTT, 5 mM EDTA-Na (pH 7.5), 10 mM MgCl2, 0.1% bovine serum albumin (BSA), and 100 µM
cold GTP for various periods of time at 30°C. The experiments were
carried out in triplicate. The K
1 values were
determined as described earlier (49).
GTPase assay.
The steady-state rate of GTPase activity was
determined by incubating 5 pmol of GTPase with 1 µM
[
-32P]GTP in a reaction mixture containing 50 mM
Tris-Cl (pH 7.5), 5 mM MgCl2, EDTA-Na (pH 7.5), 1 mM DTT,
and 0.1% BSA for various periods of time at 30°C. An aliquot (60 µl) was taken out and mixed with 390 µl of ice-cold charcoal
suspension (5% Norit SX-2 [wt/vol]). After a vortexing for 10 s, the supernatant was obtained by centrifugation at 8,000 × g for 10 min, and the residual radioactivity was measured. The
steady-state rate (Kss) was expressed as
the turnover number as described earlier (29). The actual
catalytic rate (Kcat) of GTPase activity was
determined in the presence or absence of P122RhoGAP (50 nM). Five picomoles of GTPase was incubated with 2 µM
[
-32P]GTP in a reaction mixture containing 20 mM
Tris-Cl (pH 7.5), 1.3 mM MgCl2, 2 mM EDTA-Na (pH 7.5), 1 mM
DTT, and 40 mg of BSA per ml for 10 min at 30°C. The reaction was
then stopped by the addition of stop buffer containing 100 mM Tris-Cl
(pH 7.5), 100 mM MgCl2, and 10 mM DTT. Next, the mixture
was incubated with cold reaction buffer containing 1 mM GTP with or
without 50 nM P122RhoGAP for various periods of time at
30°C. An aliquot was filtered through a prewetted nitrocellulose
filter. Thereafter, the filters were dissolved in 4 ml of distilled
water, and the radioactivity was measured. The experiments were carried
out in triplicate. The steady-state rate of GTPase activity was
determined as described elsewhere (22).
Transient transfection.
Mammalian FLAG-tagged small GTPase
expression plasmid was constructed by the following procedures. The
coding sequences for the small GTPase in pGST-RhoA, pGST-Rac1, and
pGST-Cdc42 with HindIII/EcoRI sites in both
ends were amplified by PCR. The DNA fragment was cut at the
HindIII and EcoRI sites and ligated to pFLAG-MAC (Sigma). The full length FLAG-tagged small GTPase coding sequence with the EcoRI site upstream of the initiation
methionine codon and downstream of the termination codon was
synthesized by PCR. The fragment was digested with EcoRI and
ligated into the EcoRI site of the mammalian expression
vector pEF-BOS. Similarly, pFLAG-RhoA and pFLAG-RhoA63E
were digested with EcoRI, and the DNA fragments were ligated into the EcoRI site of pEF-BOS. Cos-7 cells were transfected
with the FLAG-tagged small GTPase expression plasmid by using
DEAE-dextran as described earlier (44).
Analysis of GDP and GTP bound to FLAG-tagged small GTPase
expressed in Cos-7 cells.
Nucleotides bound to FLAG-tagged small
GTPases were measured essentially as described previously
(34). Cos-7 cells transfected with certain DNA were cultured
for 2 days and treated with either purified CNF2 or saline. After
incubation for 12 h, the cells were washed twice with 3 ml of
ice-cold Tris-buffered saline (TBS) and once with 0.5 ml of
phosphate-free RPMI 1640. Cos-7 cells were labeled for 12 h with
32PPi (NEN) at 0.1 mCi/ml in phosphate-free
RPMI 1640. The cells were washed once with ice-cold TBS, and then a
lysis buffer (10 mM Tris-Cl [pH 7.5], 150 mM NaCl, 20 mM
MgCl2, 0.5% Triton X-100, 20 µg of leupeptin per ml, 20 µg of aprotinin per ml, 1 mM phenylmethylsulfonyl fluoride) was added
to the dishes. The cells were scraped off with a rubber policeman and
collected into a 1.5-ml plastic tube; this was followed by
centrifugation at 10,000 × g for 5 min. The supernatant was gently mixed with anti-FLAG M2 affinity gel (Sigma) for
2 h at 4°C. The precipitate was then washed four times with the
lysis buffer and suspended in the sample buffer (20 mM Tris-Cl [pH
7.5], 20 mM EDTA, 2% SDS, 1 mM GDP, 1 mM GTP), followed by incubation
at 65°C for 5 min. The supernatant was spotted onto a
polyethyleneimine-cellulose thin-layer sheet (Marchery-Nägel Catalog number 801063) and developed with 1 M
KH2PO4-H3PO4 (pH 3.4).
The radioactivity was quantitated with a BAS-2000 bioimaging analyzer
(Fujix, Tokyo, Japan). The molar ratio of GDP to GTP bound to
FLAG-tagged small GTPase was determined by multiplying the ratio of
their radioactivities by 1.5.
Other procedures.
SDS-PAGE and immunoblotting were carried
out as described earlier (50). Immunodetection was carried
out by using an ECL immunodetection kit (Amersham) according to the
kit's manual. The anti-63E was diluted 1,000-fold for immunodetection.
Protein concentrations were determined by the method of Bradford
(4), with BSA as the standard.
 |
RESULTS |
CNF2 inhibits intrinsic and RhoGAP-dependent GTPase activities of
RhoA.
We used the coexpression system of CNF2 and RhoA in E. coli described previously (38). When the GST-RhoA
purified from E. coli C600(pK184, pGST-RhoA) and from
C600(pEOSW30, pGST-RhoA) were analyzed by SDS-PAGE, we observed that
the GST-RhoA coexpressed with CNF2 had an apparently slower
electrophoretic mobility, although the difference was only slight (Fig.
1). This finding indicated that GST-RhoA
is as susceptible as untagged RhoA (38) to chemical modification by coexpressed CNF2. We then analyzed the guanine nucleotide binding activities of the purified CNF2-modified and -unmodified GST-RhoA. For this purpose, GST-RhoA was incubated with a
nonhydrolyzable analog of guanine nucleotide,
[35S]GTP
S, and the reaction was terminated at various
time points. The amount of [35S]GTP
S bound was
quantified by filtration of the terminated reactions through
nitrocellulose filters. The Kd values of
CNF2-unmodified and -modified GST-RhoA for GTP
S were 11 ± 1 and 16 ± 3 nM, respectively, which were markedly lower levels
than that of posttranslationally modified RhoA but were consistent with
those expressed in bacteria (47) (Table
2). This suggested that the affinities of
CNF2-modified and CNF2-unmodified GST-RhoA were similar. The GDP
dissociation constants of CNF2-modified and -unmodified GST-RhoA were
measured. The K
1 values of CNF2-unmodified and
-modified GST-RhoA were 270 ± 70 and 160 ± 40, respectively
(Table 2). Next, the intrinsic GTPase activities of the GST-RhoA were
determined. GST-RhoA was incubated with [
-32P]GTP, and
aliquots were taken at various time points. The amount of
32Pi released from [
-32P]GTP
was quantified. As shown in Fig. 2A,
CNF2-modified GST-RhoA showed decreased GTPase activity compared to
unmodified GST-RhoA, which hydrolyzed [
-32P]GTP and
released 32Pi in a time-dependent fashion. The
steady-state rates (Kss) of GTPase activity of
CNF2-unmodified and -modified GST-RhoA were (33 ± 6) × 10
3 and (11 ± 1) × 10
3
min
1, respectively (Table 2). P122RhoGAP
stimulated the actual catalytic rate of GTPase activity of GST-RhoA 8.4-fold, while that of CNF-modified GST-RhoA was stimulated only 2.2-fold (Table 2). These results suggested that CNF2-induced modification inhibited intrinsic and RhoGAP-stimulated GTPase activities. We also purified GST-Rac1 and GST-Cdc42 expressed in the
presence or absence of CNF2 in E. coli, respectively, and assessed the effect of coexpression on the GTPase activity of these
small GTPases. Both the steady-state rate and the actual catalytic rate
of GTPase activity of GST-Rac1 were lowered when GST-Rac1 was
coexpressed with CNF2. On the other hand, coexpression of CNF2 hardly
affected GTPase activities of GST-Cdc42.

View larger version (38K):
[in this window]
[in a new window]
|
FIG. 1.
Effect of CNF2 on the electrophoretic mobility of
GST-RhoA. GST-RhoA was coexpressed with (lane 2) or without (lane 1)
CNF2 in E. coli. GST fusion protein was purified from the
E. coli homogenate by using glutathione-Sepharose beads
according to the manufacturer's instructions. Proteins were analyzed
by SDS-PAGE in a 10% gel and by subsequent staining with Coomassie
brilliant blue. The molecular masses of the standard are indicated by
arrows.
|
|

View larger version (18K):
[in this window]
[in a new window]
|
FIG. 2.
Effect of the CNF2-induced modification on GTPase
activity of Rho. (A) Effect of CNF2-induced modification on GTPase
activity of GST-RhoA. GST-RhoA coexpressed with ( ) or without ( )
CNF2 in E. coli was purified and assayed for GTPase activity
as described in Materials and Methods. (B) Effect of CNF2-induced
modification on GTPase activity of FLAG-RhoA Q63 and FLAG-RhoA E63.
FLAG-RhoA Q63 (wild type) coexpressed with ( ) or without ( ) CNF2
and FLAG-RhoA E63 coexpressed with ( ) or without ( ) CNF2 in
E. coli were purified and assayed for GTPase activity as
described in Materials and Methods. The results shown are
representative of three independent experiments.
|
|
CNF2 deamidates Q63 of RhoA coexpressed in E. coli.
Next, we tried to identify the structural change induced by CNF2. Since
the GST-RhoA we used did not contain a protease cleavage site to
separate GST from fused protein, we switched to a FLAG-RhoA system for
the preparation of FLAG peptide-tagged RhoA (FLAG-RhoA). FLAG-RhoA was
also susceptible to chemical modification by CNF2 in the E. coli coexpression system (data not shown). When purified CNF2-modified and -unmodified FLAG-RhoA were analyzed by ESI-MS performed on a TSQ-700 triple-sector quadrupole mass spectrometer, no
differences were observed between Mrs of the
proteins (not shown). This suggested that the nature of chemical
modification by CNF2 was too subtle to detect by MS. Therefore, we
generated peptide fragments by proteolytic digestion of CNF2-modified
and -unmodified FLAG-RhoA and analyzed peptides by N-terminal
sequencing, together with MS. Table 3
shows peptide mapping of the CNF2-modified FLAG-RhoA digested with
endopeptidase Lys-C. When compared to the results with the coding amino
acid sequence of FLAG-RhoA, only Q71 (Q63 in RhoA) was changed to E71
in the 30-L7 fragment. Amino acid sequencing of the corresponding
fragment, 184-L7, revealed that the 71st amino acid was Q in unmodified
FLAG-RhoA ESI-MS, and N-terminal amino acid sequence analysis of
peptides generated by endoproteinase Lys-C digestion of FLAG-RhoA
revealed that fragment 184-L7 (amino acids 60 to 106;
QVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEK) had
a predicted mass of 5,399.9 Da and an observed mass of 5,969.2 Da. The amino acid alteration at the 71st amino acid was confirmed with
peptides generated by trypsin digestion of 30-L7 fragment as shown in
Table 4. Of note, the observed mass
corresponding to the L7 fragment in both CNF2-modified and -unmodified
FLAG-RhoA was larger than that predicted from deduced amino acid
sequences (see above and Table 3). However, mass data of
trypsin-digested fragments, which cover most of the L7 fragment,
revealed no difference between the observed and the predicted masses
(Table 4). The reason for the discrepancy between observed and
predicted masses of L7 remains, however, unknown.
View this table:
[in this window]
[in a new window]
|
TABLE 3.
ESI-MS and N-terminal amino acid sequence analysis of
peptides generated by endoproteinase Lys-C digestion of
CNF2-modified FLAG-RhoA
|
|
View this table:
[in this window]
[in a new window]
|
TABLE 4.
ESI-MS and N-terminal amino acid sequence analysis of
peptides generated by trypsin digestion of CNF2-modified FLAG-RhoA
L7 fragment
|
|
Q63 belongs to one of the conserved regions among small GTPases, G-3,
which is critical in GDP-GTP exchange, GTP-induced conformational
change, and GTP hydrolysis (
3). Mutation of Q63 to L63 of
Rho
inhibited GTPase and GAP stimulation and induced the dominant
positive phenotype of Rho GTPase (
11,
40,
41). We measured
intrinsic GTPase activities of FLAG-RhoA Q63 (wild type) and FLAG-RhoA
E63 either expressed alone or coexpressed with CNF2. As shown
in Fig.
2B, FLAG-RhoA E63 as well as FLAG-RhoA coexpressed with
CNF2 revealed
decreased intrinsic GTPase activity. We compared
the electrophoretic
mobilities of CNF2-modified FLAG-RhoA and
FLAG-RhoA E63. As shown in
Fig.
3A, FLAG-RhoA coexpressed with
CNF2
revealed an electrophoretic mobility similar to that of FLAG-RhoA
E63.
FLAG-RhoA E63 coexpressed with CNF2 did not alter the electrophoretic
mobility in SDS-PAGE either. These results further support the
idea
that RhoA with Q63 deamidated to E63 by CNF2 has the lowered
GTPase
activity. We analyzed the structural alteration of FLAG-RhoA
coexpressed with CNF2 by using anti-oligopeptide antibody generated
against DTAG
EEDYDRLRPLS (anti-E63), the G-3 domain, with
altered
E63 (underlined) conserved in small GTPases. As shown in Fig.
3B, anti-E63 reacted with FLAG-RhoA coexpressed with CNF2 and
with
FLAG-RhoA E63 coexpressed with or without CNF2 but not with
FLAG-RhoA
alone. We then undertook to the express C-terminal and
N-terminal
portions of CNF2 as fusion proteins with a six-histidine
tag. The
fusion proteins were incubated with purified FLAG-RhoA
to see whether
deamidation takes place with one of the fragments
of CNF2 in vitro.
Treatment of CNF2 alone resulted in deamidation
of FLAG-RhoA, and the
C-terminal portion of CNF2 was also able
to deamidate FLAG-RhoA but the
N-terminal portion was not (Fig.
4). This
was not the case when heat-inactivated CNF2 or CNF2 fragment
was used
(not shown).

View larger version (48K):
[in this window]
[in a new window]
|
FIG. 3.
SDS-PAGE and Western blotting analyses of FLAG-RhoA.
FLAG-RhoA Q63 (wild type) coexpressed with (lane 2) or without (lane 1)
CNF2 and FLAG-RhoA E63 coexpressed with (lane 4) or without (lane 3)
CNF2 in E. coli were purified as described in Materials and
Methods. Purified proteins were analyzed by SDS-PAGE with Coomassie
brilliant blue staining (A) or by Western blotting with anti-E63
antibody (dilution, 1,000-fold) (B).
|
|

View larger version (19K):
[in this window]
[in a new window]
|
FIG. 4.
In vitro modification of FLAG-RhoA by CNF2. Results of
Western blotting analysis of FLAG-RhoA with anti-E63 antibody are
shown. Purified FLAG-RhoA was coincubated with nothing (control),
purified His-tag-CNF2 (C term.), His-tag-CNF2 (N term.), or
His-tag-CNF2 (full) at a molar ratio of 2:3 in PBS at 37°C for 30 min. The treated samples were subjected to SDS-PAGE and probed with
anti-E63 antibody (dilution, 1,000-fold).
|
|
CNF2 selectively deamidates RhoA and Rac1 coexpressed in E. coli and 21-kDa protein in Swiss 3T3 cells.
We further
analyzed the structural alterations of small GTPases of the Rho
subfamily coexpressed with CNF2 by SDS-PAGE and Western blotting by
using anti-E63 antibody. Anti-E63 reacted with GST-RhoA and GST-Rac1
coexpressed with CNF2, but it did not react with GST-Cdc42 coexpressed
with CNF2 (Fig. 5). On the other hand,
anti-E63 reacted with GST-RhoA and GST-Cdc42 coexpressed with CNF1 but
did not react with GST-Rac1 coexpressed with CNF1 (Fig. 5). These
results clearly indicated that CNF2 and CNF1 have different substrate
specificities: CNF2 preferentially deamidates RhoA and Rac1, and CNF1
preferentially deamidates RhoA and Cdc42. The data for CNF1 further
supported the observation described by Schmidt et al. (45).
To know whether the deamidation event by CNF2 takes place in Swiss 3T3
cells, homogenates of CNF2-treated and -untreated Swiss 3T3 cells were
immunodetected by using anti-E63. As shown in Fig.
6, an immunoreactive band of 21 kDa was
observed in the homogenate of CNF2-treated cells but not in that of
CNF2-untreated Swiss 3T3 cells, suggesting that protein(s) belonging to
the Rho family was deamidated by CNF2 treatment in vivo.

View larger version (37K):
[in this window]
[in a new window]
|
FIG. 5.
SDS-PAGE and Western blotting analyses of GST-fused
small GTPases. GST-RhoA (RhoA), GST-Rac1 (Rac1), and GST-Cdc42 (Cdc42)
coexpressed without (control) or with CNF1 or CNF2 in E. coli were purified. Purified proteins were analyzed by SDS-PAGE
with Coomassie brilliant blue staining (lower panel) or by Western
blotting with anti-E63 antibody (dilution, 1,000-fold) (upper panel).
|
|

View larger version (44K):
[in this window]
[in a new window]
|
FIG. 6.
Western blotting analysis of CNF2-treated Swiss 3T3 cell
homogenate with anti-E63 antibody. Homogenates (10 µg) of Swiss 3T3
cells treated with (lane 2) or without (lane 1) CNF2 (50 ng/ml) for 30 min were subjected to SDS-PAGE and probed with anti-E63 antibody
(dilution, 1,000-fold) as the secondary antibody.
|
|
CNF2 selectively induces accumulation of the GTP-bound form of the
small GTPases in Cos-7 cells.
We addressed the question of whether
CNF2-induced activation of small GTPases takes place in cultured cells.
We used Cos-7 cells to transiently express FLAG-tagged small GTPase
belonging to the Rho family, i.e., RhoA, Rac1, and Cdc42. The cells
transfected with mammalian expression vector pEF-BOS harboring the
FLAG-tagged small GTPase gene were treated with purified CNF2 and
subsequently labeled with 32Pi for 12 h
and harvested. Cells were lysed under mild conditions, and the small
GTPase was recovered from the lysate with anti-FLAG monoclonal
antibody-conjugated beads. Then the bound nucleotides were extracted
from the immunoprecipitates and applied to a
polyethyleneimine-cellulose thin-layer sheet for thin-layer
chromatography (TLC), and the percentage of GTP to small GTPase-bound
guanine nucleotide was determined. CNF2 dose dependently increased the
proportion of FLAG-RhoA GTP and FLAG-Rac1 GTP (Fig.
7). On the other hand, CNF2 slightly
increased the percentage of FLAG-Cdc42 GTP, but it was less than 2%
even at the concentration of 1,000 ng of CNF2 per ml. These results
strongly suggested that CNF2 selectively induces accumulation of the
GTP form of RhoA and Rac1 but not of Cdc42.

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 7.
Effect of CNF2 on accumulation of the GTP-bound form of
Rho subfamily GTPases in Cos-7 cells. FLAG-RhoA ( ), FLAG-RhoA E63
( ), FLAG-Rac1 ( ), and FLAG-Cdc42 ( ) were transiently expressed
in Cos-7 cells. The cells were then treated with CNF2 at the indicated
concentrations for 12 h and labeled with
32Pi. The cell lysates were subjected to
immunoprecipitation with anti-FLAG monoclonal antibody.
Immunoprecipitates were developed by TLC, and the radioactivity was
analyzed with a BAS2000. The ratio of GTP to small GTPase-bound guanine
nucleotides was indicated as a percentage.
|
|
 |
DISCUSSION |
Our findings indicate that CNF2 induces deamidation of RhoA Q63 to
E63 in E. coli. The CNF2-modified RhoA exhibited lowered intrinsic GTPase activity. Furthermore, the modified RhoA showed decreased sensitivity to Rho GAP. Gln63 of Rho is conserved in small
GTPases other than Rap and is essential for GTPase activity (3). Mutation of Q63 to L63 inhibited GTPase and GAP
stimulation and induced the dominant positive phenotype of Rho GTPase
(11, 40, 41). Somatic mutation of Ras Q61 equivalent to Rho
Q63 was shown to reduce GTPase and was suggested to contribute to the
generation of human tumors (1). Taken together, these
results suggest that CNF2 deamidates Rho Q63, which inhibits the
intrinsic GTPase activity of Rho, as well as GTPase activity stimulated by P122RhoGAP. This leads to the constitutive activation of
Rho and induces reorganization of actin stress fibers (38).
CNF1 was previously demonstrated to deamidate RhoA at Q63 and convert
it to E63 and to constitutively activate the RhoA in an in vitro assay
(18, 45). Furthermore, CNF1 (at a molar ratio of GTPase to
toxin of 16:1) was shown to partly modify Cdc42, one of the members of
the Rho subfamily (45). Rac1, however, was not modified with regard to the toxin/GTPase ratio. A higher concentration of CNF1 (at a
molar ratio of GTPase to toxin of 5:1) was shown to inhibit the GTPase
activities of Cdc42 and Rac1 in the presence or absence of
p50GAP by approximately 60 and 80%, respectively, in vitro
(32). However, it was not demonstrated whether these GTPases
are substrates for CNF1 in vivo. By using an E. coli
coexpression system, we found that CNF2 induced activation of not only
RhoA but also Rac1. The GTPase activity of Cdc42 was not affected when
coexpressed with CNF2. Furthermore, Western blotting analysis with
anti-E63 antibody demonstrated that CNF2 deamidated RhoA Q63 and Rac1
Q61 but not Cdc42 Q61. On the other hand, CNF1 was shown to deamidate
RhoA Q63 and Cdc42 Q61 but not Rac1 Q61. The data obtained with
CNF1 are consistent with the previous observations of Schmidt et al. (45). Nevertheless, these results clearly indicate that CNF2 and CNF1 share the substrate, RhoA, but that their substrate
specificities are distinct. In vivo experiments with Cos-7 cells
transiently expressing FLAG-tagged small GTPase revealed that CNF2
preferentially deamidated RhoA and Rac1.
It is tempting to speculate that the substrate specificity of CNF
toxins explains the differences between CNF1 and CNF2 toxic activities.
For example, the more intense necrotic activity of CNF2 could be due to
a stronger inflammatory effect of CNF2 associated with vascular
endothelial cell damage. Indeed, CNF2 could be a more potent inducer of
mast cell degranulation, since Rac activation and Rho activation are
activated in the secretory response of mast cells to stimuli
(39). By activating Rac1, CNF2 could also generate reactive
oxygen species that are essential for NF-
B-dependent transcriptional
regulation of interleukin-1
, which, in an autocrine manner, induce
collagenase-1 gene expression (28). Remodeling of the
extracellular matrix and consequent alterations of integrin-mediated adhesion and cytoarchitecture are central to wound healing and inflammation. Furthermore, CNF2 could also affect the host immune response, since Rac specifically regulates integrin-mediated spreading and increased adhesion of T lymphocytes (12). Finally, we
also observed that CNF2 preferentially induces formation of membrane ruffling and reorganization of actin and vinculin in quiescent Swiss
3T3 cells (data not shown). Again, the differences in
reorganization of the actin cytoskeleton and in the vinculin staining
pattern may reflect differences in the substrate specificities of CNF2 and CNF1. However, in eukaryotic cells, there is a significant cross-talk among small GTPases belonging to the Rho family
(20). Therefore, the functions of these GTPases are closely
associated. For example, Rac activates Rho and Cdc42 activates Rac. A
careful time course analysis of the effects of CNF1 and CNF2 may
provide some clues as to the sequential regulation of the small GTPase cascades.
Bordetella species such as B. pertussis, B. parapertussis, and B. bronchiseptica produce DNTs
(5, 13, 52). DNT and CNF possess similar biological
properties. DNT induces dermonecrosis in a variety of animals when
injected intradermally (5, 13, 24, 52). It inhibits
cytokinesis, induces multinucleation of cultured cells, and generates
the formation of thick actin stress fibers and focal adhesions
(24). Horiguchi et al. demonstrated that purified DNT from
B. bronchiseptica directly modifies RhoA in vitro, and the
modified RhoA revealed a slower electrophoretic mobility in SDS-PAGE
(24). Recently, these authors reported that DNT deamidates
the Q63 residue of RhoA to E63 and alters RhoA to the constitutively
active form (25). A comparison of amino acid sequences of
both CNFs and DNT revealed that these dermonecrotizing cytotoxins are
homologous in a localized C-terminal region, showing 35% identity
between CNF amino acids 824 to 929 and DNT amino acids 1263 to 1368. The fact that CNF1, CNF2, and DNT possess similar activities suggests
that they constitute a family of bacterial toxins which target
eukaryotic Rho proteins and modify their function by deamidation of
Q63. The C-terminal homologous regions of these toxins seems to be the
active domain for deamidation activity. We have shown in the present
study that the C-terminal portion of CNF2 was able to deamidate RhoA,
and similar results were observed with CNF1 (31). In that
study, the fact that the C-terminal domain lost its catalytic activity when deleted of various subdomains suggests a scattered distribution of
catalytic-site amino acids. Nevertheless, Schmidt and coworkers have
recently demonstrated that CNF1 has both deamidation and transglutamination activities and shares a catalytic dyad of cysteine and histidine residues with eukaryotic transglutaminases and cysteine proteases (46).
Despite similarities in biological activities, CNF and DNT toxins have
several distinct characteristics. The detection of proteins
[32P]ADP-ribosylated by clostridial C3 exoenzyme in
DNT-treated cells revealed multiple bands with slower and faster
electrophoretic mobilities than that of untreated control
(24). On the other hand, protein
[32P]ADP-ribosylated by EDIN or by C3 in CNF-treated
cells revealed a single band in one-dimensional slab gel
electrophoresis, and the band migrated more slowly than that of an
untreated control (16, 17, 38). Swiss 3T3 cells were highly
sensitive to intoxication by CNF2 but insensitive to that by DNT. These
results suggest that the mode of action of these toxins differs and
that CNF and DNT probably bind to different cell receptors. Comparative
studies with CNF and DNT may provide insight into the mechanism of intoxication.
 |
ACKNOWLEDGMENTS |
We thank Akira Kikuchi and Shinya Koyama for GST-Cdc42 and
helpful discussions on GTPase measurement, Yoshimi Homma for
GST-P122RhoGAP, and Hiroshi Maruta for pGST-RhoA. We also
thank Ryousuke Yamano and Junichi Yamagishi for their skillful
assistance. We thank the Research Center for Molecular Medicine,
Hiroshima University School of Medicine, The Research Facility,
Hiroshima University School of Dentistry, and the Research Facility,
Okayama University School of Dentistry, for the use of their facilities.
This work was supported in part by research grants from the Ministry of
Education, Science, Sports, and Culture, Japan (1997), the European
Community program FAIR (number 1335), and the Conseil Regional de la
region Midi-Pyrenees (number 9507783). S.Y.P. was a recipient of a
scholarship from the Ministère de l'Enseignement Supérieur
et de la Recherche.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Department of
Microbiology, Hiroshima University School of Dentistry, Kasumi 1-2-3, Hiroshima 734, Japan. Phone: (81) 82-257-5637. Fax: (81) 82-257-5639. E-mail: sugai{at}ipc.hiroshima-u.ac.jp.
This study is dedicated to the memory of Henry C. Wu, who died 12 February 1996.
Present address: Department of Pharmacology, Institute of
Pharmaceutical Sciences, Hiroshima University School of Medicine, Hiroshima 734-8551, Japan.
§
Present address: Department of Bioresource Science, School of
Agriculture, Ibaraki University, Ami-machi, Ibaraki 300-0393, Japan.
Editor:
J. T. Barbieri
 |
REFERENCES |
| 1.
|
Barbacid, M. A.
1987.
ras genes.
Annu. Rev. Biochem.
56:779-827[Medline].
|
| 2.
|
Bourne, H. R.,
D. A. Sanders, and F. McCormick.
1990.
The GTPase superfamily: a conserved switch for diverse cell functions.
Nature
348:125-131[Medline].
|
| 3.
|
Bourne, H. R.,
D. A. Sanders, and F. McCormick.
1991.
The GTPase superfamily: conserved structure and molecular mechanism.
Nature
349:117-126[Medline].
|
| 4.
|
Bradford, M. M.
1976.
A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding.
Anal. Biochem.
72:248-254[Medline].
|
| 5.
|
Bruckner, I. E., and D. G. Evans.
1939.
The toxin of Br. parapertussis and the relationship of this organism to H. pertussis and Br. bronchiseptica.
J. Pathol. Bacteriol.
48:67-78.
|
| 6.
|
Caprioli, A.,
G. Donelli,
V. Falbo,
R. Possenti,
L. G. Roda,
G. Roscetti, and F. M. Ruggeri.
1984.
A cell division-active protein from Escherichia coli.
Biochem. Biophys. Res. Commun.
118:587-593[Medline].
|
| 7.
|
Caprioli, A.,
V. Falbo,
L. G. Roda,
F. M. Ruggeri, and C. Zona.
1983.
Partial purification and characterization of an Escherichia coli toxic factor that induces morphological alteration.
Infect. Immun.
39:1300-1306[Abstract/Free Full Text].
|
| 8.
|
De Rycke, J.,
E. A. Gonzalez,
J. Blanco,
E. Oswald,
M. Blanco, and R. Boivin.
1990.
Evidence for two types of cytotoxic necrotizing factor in human and animal clinical isolates of Escherichia coli.
J. Clin. Microbiol.
28:694-699[Abstract/Free Full Text].
|
| 9.
|
De Rycke, J.,
J. F. Guillot, and R. Boivin.
1987.
Cytotoxins in non-enterotoxigenic strains of Escherichia coli isolated from feces of diarrheic calves.
Vet. Microbiol.
15:137-150[Medline].
|
| 10.
|
De Rycke, J.,
L. Phan-Thanh, and B. Bernard.
1989.
Immunochemical identification and biological characterization of cytotoxic necrotizing factor from Escherichia coli.
J. Clin. Microbiol.
27:983-988[Abstract/Free Full Text].
|
| 11.
|
Diekmann, D., and A. Hall.
1995.
In vitro binding assay for interactions of Rho and Rac with GTPase-activating proteins and effectors.
Methods Enzymol.
256:207-215[Medline].
|
| 12.
|
D'Souza-Schorey, C.,
B. Boettner, and L. Van Aelst.
1998.
Rac regulates integrin-mediated spreading and increased adhesion of T lymphocytes.
Mol. Cell. Biol.
18:3936-3946[Abstract/Free Full Text].
|
| 13.
|
Evans, D. G.
1940.
The production of pertussis antitoxin in rabbits and the neutralization of pertussis, parapertussis and bronchiseptica toxins.
J. Pathol. Bacteriol.
51:49-58.
|
| 14.
|
Falbo, V.,
T. Pace,
L. Picci,
E. Pizzi, and A. Caprioli.
1993.
Isolation and nucleotide sequence of the gene encoding cytotoxic necrotizing factor 1 of Escherichia coli.
Infect. Immun.
61:4909-4914[Abstract/Free Full Text].
|
| 15.
|
Falzano, L.,
C. Fiorentini,
G. Donelli,
E. Michel,
C. Kocks,
P. Cossart,
L. Cabanie,
E. Oswald, and P. Boquet.
1993.
Induction of phagocytic behavior in human epithelial cells by Escherichia coli.
Mol. Microbiol.
9:1247-1254[Medline].
|
| 16.
|
Fiorentini, C.
1994.
Escherichia coli cytotoxic necrotizing factor 1 increases actin assembly via the p21 Rho protein.
Parasitenkd. Zentbl. Bakteriol.
24(Suppl.):404-405.
|
| 17.
|
Fiorentini, C.
1995.
Escherichia coli cytotoxic necrotizing factor 1: evidence for induction of actin assembly by constitutive activation of the p21 Rho GTPase.
Infect. Immun.
63:3936-3944[Abstract/Free Full Text].
|
| 18.
|
Flatau, G.,
E. Lemichez,
M. Gauthier,
P. Chardin,
S. Paris,
C. Fiorentini, and P. Boquet.
1997.
Toxin-induced activation of the G protein p21 Rho by deamidation of glutamine.
Nature
387:729-733[Medline].
|
| 19.
|
Fukumoto, Y.,
K. Kaibuchi,
Y. Hori,
H. Fujioka,
S. Araki,
T. Ueda,
A. Kikuchi, and Y. Takai.
1990.
Molecular cloning and characterization of a novel type of regulatory protein (GDI) for the rho proteins, ras p21-like small GTP-binding proteins.
Oncogene
5:1321-1328[Medline].
|
| 20.
|
Hall, A.
1998.
Rho GTPases and the actin cytoskeleton.
Science
279:509-514[Abstract/Free Full Text].
|
| 21.
|
Hart, M. J.,
A. Eva,
T. Evans,
S. A. Aaronson, and R. A. Cerione.
1991.
Catalysis of guanine nucleotide exchange on the CDC42Hs protein by the dbl oncogene product.
Nature
354:311-314[Medline].
|
| 22.
|
Higashijima, T.,
K. M. Ferguson,
M. D. Smigel, and A. D. Gilman.
1987.
The effect of GTP and Mg on the GTPase activity and the fluorescent properties of G0.
J. Biol. Chem.
262:757-761[Abstract/Free Full Text].
|
| 23.
|
Homma, Y., and Y. Emori.
1995.
A dual functional signal mediator showing RhoGAP and phospholipase C-delta stimulating activities.
EMBO J.
14:286-291[Medline].
|
| 24.
|
Horiguchi, Y.,
T. Senda,
N. Sugimoto,
J. Katahira, and M. Matsuda.
1995.
Bordetella bronchiseptica dermonecrotizing toxin stimulates assembly of actin stress fibers and focal adhesions by modifying the small GTP-binding protein rho.
J. Cell Sci.
108:3243-3251[Abstract].
|
| 25.
|
Horiguchi, Y.,
N. Inoue,
M. Masuda,
T. Kashimoto,
J. Katahira,
N. Sugimoto, and M. Matsuda.
1997.
Bordetella bronchiseptica dermonecrotizing toxin induces reorganization of actin stress fibers through deamidation of Gln-63 of the GTP-binding protein Rho.
Proc. Natl. Acad. Sci. USA
94:11623-11626[Abstract/Free Full Text].
|
| 26.
|
Horii, Y.,
J. F. Beeler,
K. Sakaguchi,
M. Tachibana, and T. Miki.
1994.
A novel oncogene, ost, encodes a guanine nucleotide exchange factor that potentially links Rho and Rac signaling pathways.
EMBO J.
13:4776-4786[Medline].
|
| 27.
|
Kaibuchi, K.,
T. Mizuno,
H. Fujioka,
T. Yamamoto,
K. Kishi,
Y. Fukumoto,
Y. Hori, and Y. Takai.
1991.
Molecular cloning of the cDNA for stimulatory GDP/GTP exchange protein for smg p21s (ras p21-like small GTP-binding proteins) and characterization of stimulatory GDP/GTP exchange protein.
Mol. Cell. Biol.
11:2873-2880[Abstract/Free Full Text].
|
| 28.
|
Kheradmand, F.,
E. Werner,
P. Tremble,
M. Symons, and Z. Werb.
1998.
Role of Rac1 and oxygen radicals in collagenase-1 expression induced by cell shape change.
Science
280:898-902[Abstract/Free Full Text].
|
| 29.
|
Kikuchi, A.,
T. Yamashita,
M. Kawata,
K. Yamamoto,
K. Ikeda,
T. Tanimoto, and Y. Takai.
1988.
Purification and characterization of a novel GTP-binding protein with a molecular weight of 24,000 from bovine brain membranes.
J. Biol. Chem.
263:2897-2904[Abstract/Free Full Text].
|
| 30.
|
Lancaster, C. A.,
P. M. Taylor-Harris,
A. J. Self,
S. Brill,
H. E. van Erp, and A. Hall.
1994.
Characterization of rhoGAP. A GTPase-activating protein for rho-related small GTPases.
J. Biol. Chem.
269:1137-1142[Abstract/Free Full Text].
|
| 31.
|
Lemichez, E.,
G. Flatau,
M. Bruzzone,
P. Boquet, and M. Gauthier.
1997.
Molecular localization of the Escherichia coli cytotoxic necrotizing factor CNF1 cell-binding and catalytic domains.
Mol. Microbiol.
24:1061-1070[Medline].
|
| 32.
|
Lerm, M.,
J. Selzer,
A. Hoffmeyer,
U. R. Rapp,
K. Aktories, and G. Schmidt.
1999.
Deamidation of Cdc42 and Rac by Escherichia coli cytotoxic necrotizing factor 1: activation of c-Jun N-terminal kinase in HeLa cells.
Infect. Immun.
67:496-503[Abstract/Free Full Text].
|
| 33.
|
Mizuno, T.,
K. Kaibuchi,
T. Yamamoto,
M. Kawamura,
T. Sakoda,
H. Fujioka,
Y. Matsuura, and Y. Takai.
1991.
A stimulatory GDP/GTP exchange protein for smg p21 is active on the post-translationally processed form of c-Ki-ras and rhoA p21.
Proc. Natl. Acad. Sci. USA
88:6442-6446[Abstract/Free Full Text].
|
| 34.
|
Muroya, K.,
S. Hattori, and S. Nakamura.
1992.
Nerve growth factor induces rapid accumulation of the GTP-bound form of p21ras in rat pheochromocytoma PC12 cells.
Oncogene
7:277-281[Medline].
|
| 35.
|
Nobes, C., and A. Hall.
1994.
Regulation and function of the Rho subfamily of small GTPases.
Curr. Opin. Genet. Dev.
4:77-81[Medline].
|
| 36.
|
Oswald, E., and J. De Rycke.
1990.
A single protein of 110 kDa is associated with the multinucleating and necrotizing activity coded by the Vir plasmid of Escherichia coli.
FEMS Microbiol. Lett.
68:279-284.
|
| 37.
|
Oswald, E.,
J. De Rycke,
J. F. Guillot, and R. Boivin.
1989.
Cytotoxic effect of multinucleation in HeLa cell cultures associated with the presence of Vir plasmid in Escherichia coli.
FEMS Microbiol. Lett.
58:95-100.
|
| 38.
|
Oswald, E.,
M. Sugai,
A. Labigne,
H. C. Wu,
C. Fiorentini,
P. Boquet, and A. D. O'Brien.
1994.
Cytotoxic necrotizing factor type 2 produced by virulent Escherichia coli modifies the small GTP-binding proteins Rho involved in assembly of actin stress fibers.
Proc. Natl. Acad. Sci. USA
91:3814-3818[Abstract/Free Full Text].
|
| 39.
|
Price, L. S.,
J. C. Norman,
A. J. Ridley, and A. Koffer.
1995.
The small GTPases Rac and Rho as regulators of secretion in mast cells.
Curr. Biol.
5:68-73[Medline].
|
| 40.
|
Renshaw, M. W.,
D. Taksoz, and M. A. Schwartz.
1996.
Involvement of the small GTPase Rho in integrin-mediated activation of mitogen-activated protein kinase.
J. Biol. Chem.
271:21691-21694[Abstract/Free Full Text].
|
| 41.
|
Ridley, A. J.
1995.
Microinjection of Rho and Rac into quiescent Swiss 3T3 cells.
Methods Enzymol.
256:313-320[Medline].
|
| 42.
|
Ridley, A. J., and A. Hall.
1994.
Signal transduction pathways regulating Rho-mediated stress fibre formation: requirement for a tyrosine kinase.
EMBO J.
13:2600-2610[Medline].
|
| 43.
|
Ridley, A. J.,
H. F. Paterson,
C. L. Johnston,
D. Diekmann, and A. Hall.
1992.
The small GTP-binding protein rac regulates growth factor-induced membrane ruffling.
Cell
70:401-410[Medline].
|
| 44.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, New York, N.Y.
|
| 45.
|
Schmidt, G.,
P. Sehr,
M. Wilm,
J. Selzer,
M. Mann, and K. Aktories.
1997.
Gln 63 Rho is deamidated by Escherichia coli cytotoxic necrotizing factor-1.
Nature
387:725-729[Medline].
|
| 46.
|
Schmidt, G.,
J. Selzer,
M. Lerm, and K. Aktories.
1998.
The Rho-deamidating cytotoxic necrotizing factor 1 from Escherichia coli possesses transglutaminase activity. Cysteine 866 and histidine 881 are essential for enzyme activity.
J. Biol. Chem.
273:13669-13674[Abstract/Free Full Text].
|
| 47.
|
Self, A. J., and A. Hall.
1995.
Purification of recombinant Rho/Rac/G25K from Escherichia coli.
Methods Enzymol.
256:3-10[Medline].
|
| 48.
|
Settleman, J.,
C. F. Albright,
L. C. Foster, and R. A. Weinberg.
1992.
Association between GTPase activators for Rho and Ras families.
Nature
359:153-154[Medline].
|
| 49.
|
Shoji, I.,
A. Kikuchi,
S. Kuroda, and Y. Takai.
1989.
Kinetic analysis of the binding of guanine nucleotide to bovine brain smg p25A.
Biochem. Biophys. Res. Commun.
162:273-281[Medline].
|
| 50.
|
Sugai, M.,
K. Hashimoto,
A. Kikuchi,
S. Inoue,
H. Okumura,
K. Matsumoto,
Y. Goto,
H. Ohgai,
K. Moriishi,
B. Syuto, et al.
1992.
Epidermal cell differentiation inhibitor ADP-ribosylates small GTP-binding proteins and induces hyperplasia of epidermis.
J. Biol. Chem.
267:2600-2604[Abstract/Free Full Text].
|
| 51.
|
Sugai, M.,
T. Kawamoto,
S. Y. Pérès,
Y. Ueno,
H. Komatsuzawa,
T. Fujiwara,
H. Kurihara,
H. Suginaka, and E. Oswald.
1998.
The cell cycle-specific growth-inhibitory factor produced by Actinobacillus actinomycetemcomitans is a cytolethal distending toxin.
Infect. Immun.
66:5008-5019[Abstract/Free Full Text].
|
| 52.
|
Wardlaw, A. C., and R. Parton.
1983.
Bordetella pertussis toxins.
Pergamon Press, Ltd., Oxford, England.
|
Infection and Immunity, December 1999, p. 6550-6557, Vol. 67, No. 12
0019-9567/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Grande, K. K., Meysick, K. C., Rasmussen, S. B., O'Brien, A. D.
(2009). Cytotoxic Necrotizing Factor Type 1-Neutralizing Monoclonal Antibody NG8 Recognizes Three Amino Acids in a C-Terminal Region of the Toxin and Reduces Toxin Binding to HEp-2 Cells. Infect. Immun.
77: 170-179
[Abstract]
[Full Text]
-
McNichol, B. A., Rasmussen, S. B., Carvalho, H. M., Meysick, K. C., O'Brien, A. D.
(2007). Two Domains of Cytotoxic Necrotizing Factor Type 1 Bind the Cellular Receptor, Laminin Receptor Precursor Protein. Infect. Immun.
75: 5095-5104
[Abstract]
[Full Text]
-
Lockman, H. A., Gillespie, R. A., Baker, B. D., Shakhnovich, E.
(2002). Yersinia pseudotuberculosis Produces a Cytotoxic Necrotizing Factor. Infect. Immun.
70: 2708-2714
[Abstract]
[Full Text]
-
Yamaguchi, T., Hayashi, T., Takami, H., Ohnishi, M., Murata, T., Nakayama, K., Asakawa, K., Ohara, M., Komatsuzawa, H., Sugai, M.
(2001). Complete Nucleotide Sequence of a Staphylococcus aureus Exfoliative Toxin B Plasmid and Identification of a Novel ADP-Ribosyltransferase, EDIN-C. Infect. Immun.
69: 7760-7771
[Abstract]
[Full Text]
-
Meysick, K. C., Mills, M., O'Brien, A. D.
(2001). Epitope Mapping of Monoclonal Antibodies Capable of Neutralizing Cytotoxic Necrotizing Factor Type 1 of Uropathogenic Escherichia coli. Infect. Immun.
69: 2066-2074
[Abstract]
[Full Text]
-
Umata, T., Hirata, M., Takahashi, T., Ryu, F., Shida, S., Takahashi, Y., Tsuneoka, M., Miura, Y., Masuda, M., Horiguchi, Y., Mekada, E.
(2001). A Dual Signaling Cascade That Regulates the Ectodomain Shedding of Heparin-binding Epidermal Growth Factor-like Growth Factor. J. Biol. Chem.
276: 30475-30482
[Abstract]
[Full Text]