Previous Article | Next Article ![]()
Infection and Immunity, September 1999, p. 4827-4833, Vol. 67, No. 9
Departments of
Pediatrics,1 Internal
Medicine,3 and
Microbiology,4 University of Iowa
College of Medicine, Iowa City, Iowa, and Department of
Immunology, Lerner Research Institute, The Cleveland Clinic Foundation,
Cleveland, Ohio2
Received 10 March 1999/Returned for modification 13 April
1999/Accepted 12 May 1999
The pulmonary epithelium acts as a barrier to keep the normal lung free
from infection from inhaled or aspirated microorganisms. The innate
mucosal defenses of the lung include the production of several factors
with antimicrobial properties, such as proteins and peptides
(30). Cystic fibrosis, a disease characterized by chronic
airway infection in the absence of any demonstrable systemic immune
defect (40), may represent a human disease caused by
defective pulmonary mucosal defenses. One proposed mechanism for the
susceptibility of cystic fibrosis patients to chronic respiratory
infection and inflammation is the inactivation of salt-sensitive
antimicrobial peptides, such as To investigate the role the Cloning of RBD-1 and RBD-2.
The HBD-1 mature peptide
sequence (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKS) was used to screen the
GenBank dbest database of expressed sequence tags (ESTs) by using the
National Center for Biotechnology Information BLAST program. The search
identified three identical rat ESTs from a normalized rat kidney cDNA
library with high sequence similarity to HBD-1. Three clones contained part of the open reading frame (ORF) for putative rat
0019-9567/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Molecular Cloning and Characterization of Rat Genes
Encoding Homologues of Human
-Defensins
![]()
ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
-Defensins are cationic peptides with broad-spectrum
antimicrobial activity that may play a role in mucosal defenses of
several organs. They have been isolated in several species, and in
humans, two
-defensins have been identified. Here, we report the
identification of two genes encoding
-defensin homologues in the
rat. Partial cDNAs were found by searching the expressed-sequence-tag
database, and primers were designed to generate full-length mRNA coding sequences. One gene was highly similar to the human
-defensin-1 (HBD-1) gene and mouse
-defensin-1 gene at both the nucleic acid and
amino acid levels and was termed rat
-defensin-1 (RBD-1). The other
gene, named RBD-2, was homologous to the HBD-2 and bovine tracheal
antimicrobial peptide (TAP) genes. The predicted prepropeptides were
strongly cationic, were 69 and 63 residues in length for RBD-1 and
RBD-2, respectively, and contained the six-cysteine motif
characteristic of
-defensins. The
-defensin genes mapped closely
on rat chromosome 16 and were closely linked to the
-defensins genes, suggesting that they are part of a gene cluster, similar to the
organization reported for humans. Northern blot analysis showed that
both RBD-1 and RBD-2 mRNA transcripts were ~0.5 kb in length; RBD-1
mRNA was abundantly transcribed in the rat kidney, while RBD-2 was
prevalent in the lung. Reverse transcription-PCR indicated that RBD-1
and RBD-2 mRNAs were distributed in a variety of other tissues. In the
lung, RBD-1 mRNA expression localized to the tracheal epithelium while
RBD-2 was expressed in alveolar type II cells. In conclusion, we
characterized two novel
-defensin homologues in the rat. The rat may
be a useful model to investigate the function and contribution of
-defensins to host defense in the lung, kidney, and other tissues.
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
-Defensins are cationic
antimicrobial peptides that comprise part of the innate immune system
at mucosal surfaces (6, 14). Epithelial
-defensins were
first described for cows (8) and subsequently identified in
several species, including sheep (22), pigs (43),
mice (1, 21, 28), and humans (3, 17). Two
-defensins of epithelial origin were recently identified in human
cells: human
-defensin-1 (HBD-1) and HBD-2 (3, 17). HBD-1
expression was most abundant in the urogenital tract (38, 44), while HBD-2 expression predominated in skin and in the lung
(2, 17, 32).
-defensins, by an elevated airway
surface liquid salt content (16, 33). However, the relative
contribution that
-defensins make to host defenses in the lung is unknown.
-defensins play in pulmonary defenses,
it would be advantageous to identify genes for homologous peptides in
laboratory animal models. Here, we report the discovery of rat genes
encoding two new peptides homologous to the human
-defensins. Both
rat gene products are expressed in the lung. The rat may be a useful
model to study the activity and function of
-defensins in the lung
and other epithelium-lined organs.
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
-defensin-1 (RBD-1). Primer sequences designed for the partial RBD-1 sequence were
used to clone the full-length cDNA from a rat kidney cDNA library by
PCR. Similar methods were used to search for a homologue of HBD-2. The
full HBD-2 amino acid sequence
( M RVLYLLFSFLFI FLMPLPGVFGGIGDPVTCLKSGAICHPVFC PRRYKQIGTCGLPGTKC)
was used to screen the database, and two identical ESTs from a
rat lung cDNA library were found. One clone contained the entire 192-bp
ORF for putative RBD-2. A set of primers designed from the RBD-2
sequence was used to clone the cDNA from rat lung by reverse
transcription (RT)-PCR.
-Defensin mapping.
The rat radiation hybrid panel was
purchased commercially (Research Genetics, Huntsville, Ala.). The
following primers were selected for PCR: RBD-1-forward
(5'-GGACGCAGAACAGATCAATACCGA-3'), RBD-1-reverse
(5'-TCTTCAAACCACTGTCAACTCCTG-3'), RBD-2-forward (5'-TTAATTTGGTTTGTTTTGTGCAT-3'), RBD-2-reverse
(5'-CATGCCTGACCAAAGGAGGCGTA-3'), rat
-defensin-3
(RAD-3)-forward (5'-TACCGACTCTGTTGCTGAGCA-3'), RAD-3-reverse
(5'-GTCTAGGACACAACATACTAC-3'), RAD-4-forward
(5'-TGGCCGCATCTACCGTCTCTG-3'), and RAD-4-reverse
(5'-AACATGGGACAAGTAACAGTC-3').
Tissue, cell, and RNA isolation.
Tissues were obtained from
adult Sprague-Dawley rats for screening of
-defensin mRNA
expression. In developmental studies, timed pregnant (sperm
positive = day 0) Sprague-Dawley rats were obtained from Sasco
(Omaha, Nebr.). Fetal lung tissues were obtained on days 16, 18, 19, and 21 of gestation and postnatal days 1, 3, 5, and 10. Isolated
tissues were flash frozen in liquid nitrogen and stored at
80°C.
Adult type II cells were isolated by using enzymatic digestion,
differential adherence, and panning as described by Dobbs et al.
(9). The majority of cells were tannic acid positive
(>90%), and the viability was >98% as determined by trypan blue
exclusion, as reported previously (25). The Animal Care and
Use Committees of the University of Iowa and The Cleveland Clinic
approved the protocols. Total RNA was isolated by standard methods as
previously described (8, 26, 32).
Detection of
-defensin mRNA by RT-PCR.
RT-PCR was
performed as follows. One microgram of total RNA from each sample was
reverse transcribed with random hexamer primers by using the
SuperScript transcription system (Gibco BRL) according to the
manufacturer's instructions. Specific primers were designed from the
registered sequences of RBD-1 (GenBank accession no. AF068860) and
RBD-2 (GenBank accession no. AF068861). The primer sequences used for
cloning RBD-1 in rat tissue were as follows: forward,
GACCCTGACTTCACCGACAT, and reverse,
CCTGCAACAGTTGGGCTTAT. Additional RBD-1 primers used for
detection were as follows: forward, CTTGGACGCAGAACAGATCA,
and reverse, TCCACAAGTGCCAATCTGTC. The primer sequences for RBD-2 used in all experiments were as follows: forward, ATTTCTCCTGGTGCTGCTGT, and reverse,
TCCACAAGTGCCAATCTGTC. The predicted product sizes were 225 bp for RBD-1 and 132 bp for RBD-2. Each RBD-1 reaction mixture
contained an approximately 1.25 pM concentration of the primers, 3 mM
Mg2+, and 5 µl of the RT reaction product for a total
volume of 20 µl. Each RBD-2 reaction mixture contained an
approximately 0.5 pM concentration of the primers, 3 mM
Mg2+, and 10 µl of the RT reaction product for a total
volume of 30 µl. After an initial denaturing step (95°C for 3 min),
30 cycles of denaturing (94°C for 1 min), annealing (60°C for
30 s for RBD-1 and 63°C for 30 s for RBD-2), and extending
(72°C for 1 min), followed by 5 min at 72°C for elongation, were
conducted. A 12-µl aliquot of the RBD-1 PCR product and an 18-µl
aliquot of the RBD-2 product were electrophoresed on a 2% agarose gel
and visualized with ethidium bromide. As an internal control,
glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was amplified in both
RBD-1 and RBD-2 reactions with the following primers: forward,
AGACAGCCGCATCTTCTTGT, and reverse, CTTGCCGTGGGTAGAGTCAT.
Northern blot analysis.
For Northern blot analysis, total
RNA (10 µg) was denatured and separated on 1.2% agarose-formaldehyde
gels and then blotted onto nucleic acid transfer membranes
(Hybond-N+; Amersham). Northern blots were hybridized
overnight with 32P-, end-labeled oligonucleotide probes in
35% (vol/vol) formamide-5× Denhardt's solution-5× SSC (1× SSC is
0.15 M NaCl plus 0.015 M sodium citrate)-1% sodium dodecyl sulfate
(SDS)-100 µg of yeast RNA per ml at 42°C. Membranes were washed
with 2× SSC-0.1% SDS five times at room temperature for 50 min and
then twice at 55°C for 15 min. The membranes were stripped of the
oligonucleotide probes by incubation in 0.1× SSC-0.1% SDS at 70°C
for 30 min. The sequences of the oligonucleotide probes were
CCATTTTGGAGGCATCGGTATTGATCTGTTCTGCGTC (RBD-1),
TGGAGGAGCAAATTCTGTTCATCCCATTGGTTCTTGG (RBD-2),
CAGTTTTAGTCCCTTCATCTGTTTTTGGGGTAGGTTC (
-defensin;
generously provided by Gill Diamond), and
AGCCCCRGCCTTCTCCATGGTRGTGAAGACVCCR (GAPDH). Blots were
exposed to X-Omat films (Eastman Kodak Co., Rochester, N.Y.) with
intensifying screens at 80°C.
Southern blot analysis. Rat genomic DNA (10 µg) was digested overnight with restriction endonucleases, size separated by agarose gel (1.0%) electrophoresis, and transferred to a nylon membrane (Hybond-N+). For reduced-stringency conditions, the membrane was hybridized with 32P-labeled RBD-2 cDNA overnight in 35% (vol/vol) formamide-5× Denhardt's solution-5× SSC-1% SDS-100 mg of yeast RNA per ml at 42°C. The filter was washed with 2× SSC-0.1% SDS five times at room temperature for 10 min each and then twice at 58°C for 15 min. The membrane was exposed to film in the presence of an intensifying screen for 1 week. The filter was stripped of the probe by incubation in 0.5 M NaOH-1.5 M NaCl for 30 min at 37°C and then checked by autoradiography. For high-stringency conditions, the membrane was then hybridized with the probe overnight in 50% (vol/vol) formamide-5× Denhardt's solution-5× SSC-1% SDS-100 mg of yeast RNA per ml at 42°C. The filter was washed with 2× SSC-0.1% SDS five times at room temperature for 10 min each and then twice with 0.1× SSC-0.1% SDS at 65°C for 15 min. The membrane was exposed to film in the presence of an intensifying screen for 10 days.
In situ hybridization. We followed methods that were previously used to localize HBD-1 mRNA in urogenital tissues (38). Sense and antisense 35S-UTP, 35S-CTP (Amersham), and double-labeled RBD-1 and RBD-2 riboprobes were prepared from linearized cDNA plasmids and hybridized with frozen sections of rat kidney and lung tissue according to published methods (42). The sections were coated with NTB-2 autoradiography emulsion (Eastman Kodak Co.) diluted 1:1 in distilled H2O, air dried, and exposed for 4 to 12 weeks at 4°C before being developed. Sections were counterstained with toluidine blue, and the signals were localized by using bright-field and dark-field microscopy.
Assay of rat BAL fluid for antimicrobial activity.
Bronchoalveolar lavage (BAL) fluid was obtained from four rats by
washing the lungs twice with 2-ml volumes of phosphate-buffered saline.
The BAL fluid samples were pooled for analysis. A quantitative luminescence assay was used to screen rat BAL fluid for antimicrobial activity. The assay employs Escherichia coli DH5
containing the luminescence plasmid pCGLS1 (12, 32) and
allows rapid quantitative assessment of bactericidal activity. We
validated our assay by showing a correlation of luminescence with
viable cell numbers. Luminescence is an energy-requiring activity that
is directly related to bacterial viability as determined by plate
counts (data not shown). Bacteria were grown at 30°C in Luria-Bertani
medium, centrifuged, and resuspended at a concentration of
107 cells/ml in 10 mM potassium phosphate, pH 7.2, with 1%
Luria-Bertani medium. Bacteria (106) were then incubated
with mouse BAL fluid in 96-well plates (Optiplate; Packard Instruments)
for 4 h, and luminescence was measured with a microtiter dish
luminometer (Anthos). To assess the salt sensitivity of the BAL fluid
activity, the assays were performed in the presence of 0 or 150 mM NaCl.
| |
RESULTS |
|---|
|
|
|---|
Cloning and structure of rat
-defensin cDNAs.
By searching
the dbest database by using either the HBD-1 or HBD-2 peptide sequence,
genes encoding two homologous rat proteins were found in normalized rat
kidney or lung cDNA libraries. These sequences were termed RBD-1 and
RBD-2, respectively. The RBD-1 clones identified in the database did
not contain a full-length ORF. In order to obtain the entire coding
sequence for RBD-1, anchored PCR was performed by using a kidney cDNA
library template, part of the RBD-1 sequence as one primer, and a
vector sequence as the other primer. The composite cDNA sequence
contains an ORF 210 bp in length encoding a putative 69-amino-acid
peptide which was ~65% identical to HBD-1 and 92.5% identical to
mouse
-defensin-1 (MBD-1) (Fig. 1).
The RBD-2 cDNA contains a 192-bp ORF, and the putative RBD-2 peptide
sequence is 53% identical to HBD-2 (Fig. 1).
|
Chromosomal localization and Southern blot analysis.
Radiation
hybrid mapping demonstrated that the RBD-1 and RBD-2 genes were linked
to each other at a distance of 3.8 centirads (cR) with a limits of
detection (LOD) score of 24.32. A rough estimate of the physical
distance between RBD-1 and RBD-2 may be obtained by determining the
correlation between cR estimates and known physical distances. While
such data do not exist for the rat panel we used, data from the human
GeneBridge 4 panel, a radiation hybrid panel constructed with a similar
radiation dose, suggest that 1 Mb of DNA is represented by roughly 3.7 cR. This metric suggests that the genes for RBD-1 and RBD-2 are
separated by about 1 Mb of DNA. Based on syntenic groups of markers in
the rat, human, and mouse, it was expected that these two rat
-defensin genes would be localized to rat chromosome 16. Pairwise
analysis with both RBD-1 and RBD-2 demonstrated strong linkage to
markers on chromosome 16. A framework map of five genetic markers was constructed for the distal 16p region by using multipoint analysis and
is shown in Fig. 2A. RBD-2 and D16RAT14
were found to be completely linked and are shown occupying the same
location in the framework map. Radiation hybrid mapping of rat
neutrophil defensins RAD-3 and RAD-4 suggests that both genes are
completely linked to RBD-1 (Fig. 2A).
|
Tissue distribution and ontogeny of rat
-defensin mRNA
expression.
Total RNA from rat tissues was screened for rat
-defensin mRNA expression. Northern blot analysis (Fig.
3A) of the two rat
-defensin genes
showed that both transcripts were ~500 nucleotides in length. The
predominant site of RBD-1 mRNA expression was the kidney, and that for
RBD-2 was the lung. Lower levels of RBD-2 mRNA were also detected in
the trachea and tongue. The expression of RBD-2 in the trachea was
variable, as we failed to detect the message in samples by in situ
hybridization or RT-PCR (see below). By contrast, a member of another
subclass of defensin, an
-defensin expressed in small intestinal
Paneth cells, showed a distinct, nonoverlapping pattern of mRNA
expression.
|
|
Localization of
-defensin mRNA by in situ hybridization.
To
localize the expression of RBD-1 and RBD-2 mRNAs to specific cell
types, we performed in situ hybridization on tissue sections from the
trachea, lung, and kidney. As shown in Fig.
5A, RBD-1 mRNA expression was detected in
the tracheal epithelium and kidney cortex epithelia but not in the
distal lung. In the trachea, expression was confined to the tracheal
epithelium and was diffuse. Expression in the kidney cortex was
restricted to epithelia of the distal tubules. In contrast, RBD-2
expression was noted in a population of cuboidal cells in the alveolus
consistent with alveolar type II cells but not in the tracheal
epithelium or kidney (Fig. 5B).
|
Rat BAL fluid exhibits salt-sensitive antimicrobial activity.
The antimicrobial activity of
-defensins is characteristically
inhibited by salt (14). We hypothesized that if the RBD-1 or
RBD-2 gene products were secreted into airway surface liquid, salt-sensitive antimicrobial activity would be present in rat BAL
fluid. We isolated BAL fluid from normal rats and tested its ability to
kill bacteria in the presence or absence of NaCl. As shown in Fig.
6, rat BAL fluid killed E. coli in a concentration-dependent manner. When the BAL fluid
samples were tested in the presence of 150 mM NaCl, the antimicrobial
activity was lost. Thus, rat BAL fluid, like human airway surface
liquid (33), exhibited antimicrobial activity that was
inhibited by salt.
|
| |
DISCUSSION |
|---|
|
|
|---|
In this study we have identified the first
-defensin genes in
the rat. The gene products, RBD-1 and RBD-2, are homologous to
-defensins characterized in other species, including humans. The rat
- and
-defensins localized to chromosome 16 and were closely
linked. Investigation of the tissue distribution of the rat
-defensin mRNAs showed an organ-specific distribution. RBD-1, like
its human homologue, was abundantly expressed in the kidney; RBD-2 was
most abundant in the lung. In the lung, RBD-1 was expressed in the
tracheal epithelium while RBD-2 was expressed in tracheal epithelia and
alveolar type II cells. We found that rat BAL fluid exhibited
salt-sensitive microbicidal activity. Members of the
-defensin class
of antimicrobial peptides are salt sensitive (14, 32);
therefore, the rat
-defensins may contribute to the activity in BAL
fluid. Since both RBD-1 and RBD-2 were expressed in the lung, the rat
may be a useful small animal model for further study of the role
-defensins play in the pulmonary innate defense system.
The RBD-1 and RBD-2 sequences were highly similar to other published
-defensin sequences, including those of the human genes (3, 8,
17). Interestingly, the RBD-2 amino acid sequence differs from
other known sequences in the spacing between the second and third
cysteine residues (Fig. 1). Other
-defensins reported to date have
had four intervening amino acids between these cysteine residues. In
contrast, the putative RBD-2 amino acid sequence has only three
residues between the cysteines and diverges from the consensus motif.
The six cysteine residues are otherwise conserved in both RBD-1 and
RBD-2.
Radiation hybrid panel results revealed that RBD-1 and RBD-2 are
closely linked on rat chromosome 16 and near the
-defensins. This
suggests that the rat
- and
-defensin genes lie as a cluster on
chromosome 16, in a region syntenic to human chromosome 8. The defensin
loci in humans (18, 23, 24), mice (21), cattle (13), and sheep (22) are also known to consist of
gene clusters. The observation that defensin loci exist as gene
clusters in several species has led to the speculation that these genes
arose from the duplication of an ancestral gene (4, 24). Our
data from the rat add further support to that hypothesis.
In some species, notably cattle and sheep, there are a collection of
several HBD-2-like genes (7, 20, 31, 36). These genes are
very similar in sequence and genomic organization but have distinct
patterns of tissue expression. For example, bovine TAP, lingual
antimicrobial peptide (LAP), and enteric
-defensin (EBD) have
approximately 90% sequence identity, but the predominant sites of
expression are tracheal mucosa, tongue epithelia, and distal enteric
mucosa, respectively. Our Southern blot analysis suggests that the rat
genome may also contain additional RBD-2-related genomic sequences
(similar genes or pseudogenes), a possibility currently under investigation.
The rat
-defensin genes were expressed in a tissue-specific manner.
RBD-1, like its human (3, 38, 44) and mouse (1, 21,
28) homologues, was abundantly expressed in the kidney. The RBD-1
mRNA localized to the distal tubules of the kidney cortex, as
previously noted for MBD-1 (1) and HBD-1 (38).
RBD-1 was also detected in the tracheal epithelium, similar to MBD-1
(1, 21, 28). However, in contrast to MBD-1, RBD-1 expression
was absent from the lung. The predominant site of RBD-2 expression was
the lung, specifically the alveolar type II cells. The type II cells
are also a site of lysozyme production in the rat (15). The
human homologue of RBD-2 is also expressed in the lung (2, 17,
32). The human (2, 32) and bovine (7)
homologues of RBD-2 are also expressed in the respiratory tract but
predominantly in airway epithelia. This feature may suggest a
distinction of some details regarding innate host defense in rodents
compared with other mammals.
RBD-2 mRNA expression was developmentally regulated in the lung. The transcript was undetectable until just prior to birth (day 19). This pattern of regulation is reminiscent of several pulmonary genes important in perinatal adaptation, including the genes for surfactant protein A (34), surfactant protein B (41), and the epithelial sodium channel subunits (37, 39). This suggests that RBD-2 contributes to host defenses in the perinatal period and later.
Rat BAL fluid exhibited salt-sensitive microbicidal activity. The
activity of
-defensin peptides studied to date is characteristically salt sensitive (14). Recent studies suggest that disruption of mucosal innate immunity may contribute to the development of chronic
pulmonary infection in cystic fibrosis (16, 32, 33). Alterations in airway surface liquid NaCl concentration may inhibit the
activity of salt-sensitive antimicrobial factors, including the
-defensins (16, 32, 33). Several other antimicrobial factors in airway surface liquid, including lysozyme and secretory leukocyte protease inhibitor, behave in a salt-sensitive fashion (5, 10, 11, 19, 27, 33); thus, the relative contribution of
the rat
-defensins to the killing activity in airway surface liquid
is unknown. Further study is needed to determine the role of RBD-1 and
RBD-2 in the microbicidal activity of rat BAL fluid.
The availability of a small animal model expressing homologues of HBD-1 and HBD-2 may facilitate further study of the role these peptides play in the mucosal defenses of the lung, kidney, and other organ systems.
| |
ACKNOWLEDGMENTS |
|---|
We thank Bento Soares and Val Sheffield for helpful advice and assistance with this project. We acknowledge Anne Black (Medical College of Wisconsin) for providing unpublished rat radiation hybrid data and Ann McClain (University of Iowa) and Dennis Wilk and Yang Yu (The Cleveland Clinic Foundation) for technical assistance.
This work was supported in part by the following grants and organizations: NIH P50 HL-61234-01 SCOR (P.B.M. and B.F.T.), NIH HL61234 (C.L.B.), AI-32234 (C.L.B.), AI-32738 (C.L.B.), Cystic Fibrosis Foundation (97ZO; P.B.M.), and the Children's Miracle Network Telethon (P.B.M.). P.B.M. is the recipient of a Career Investigator Award from the American Lung Association.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Department of Pediatrics, University of Iowa College of Medicine, Iowa City, IA 52242. Phone: (319) 356-4866. Fax: (319) 356-7171. E-mail: paul-mccray{at}uiowa.edu.
Editor: J. R. McGhee
| |
REFERENCES |
|---|
|
|
|---|
| 1. |
Bals, R.,
M. J. Goldman, and J. M. Wilson.
1998.
Mouse -defensin 1 is a salt-sensitive antimicrobial peptide present in epithelia of the lung and urogenital tract.
Infect. Immun.
66:1225-1232 |
| 2. |
Bals, R.,
X. Wang,
Z. Wu,
T. Freeman,
V. Bafna,
M. Zasloff, and J. M. Wilson.
1998.
Human -defensin 2 is a salt-sensitive peptide antibiotic expressed in human lung.
J. Clin. Investig.
102:874-880[Medline].
|
| 3. | Bensch, K. W., M. Raida, H. J. Magert, P. Schulz-Knappe, and W. G. Forssmann. 1995. hBD-1: a novel beta-defensin from human plasma. FEBS Lett. 368:331-335[Medline]. |
| 4. | Bevins, C. L., D. E. Jones, A. Dutra, J. Schaffzin, and M. Muenke. 1996. Human enteric defensin genes: chromosomal map position and a model for possible evolutionary relationships. Genomics 31:95-106[Medline]. |
| 5. | Davies, R. C., A. Neuberger, and B. M. Wilson. 1969. The dependence of lysozyme activity on pH and ionic strength. Biochim. Biophys. Acta 178:294-305[Medline]. |
| 6. |
Diamond, G., and C. L. Bevins.
1998.
-Defensins: endogenous antibiotics of the innate host defense response.
Clin. Immunol. Immunopathol.
88:221-225[Medline].
|
| 7. |
Diamond, G.,
D. E. Jones, and C. L. Bevins.
1993.
Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.
Proc. Natl. Acad. Sci. USA
90:4596-4600 |
| 8. |
Diamond, G.,
M. Zasloff,
H. Eck,
M. Brasseur,
W. L. Maloy, and C. L. Bevins.
1991.
Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA.
Proc. Natl. Acad. Sci. USA
88:3952-3956 |
| 9. | Dobbs, L. G., R. Gonzalez, and M. C. Williams. 1986. An improved method for isolating type II cells in high yield and purity. Am. Rev. Respir. Dis. 134:141-145[Medline]. |
| 10. | Ellison, R. T., and T. J. Giehl. 1991. Killing of gram-negative bacteria by lactoferrin and lysozyme. J. Clin. Investig. 88:1080-1091. |
| 11. |
Fleming, A.
1922.
On a remarkable bacteriolytic element found in tissues and secretions.
Proc. R. Soc. (London)
93:306-319 |
| 12. |
Frackman, S.,
M. Anhalt, and K. H. Nealson.
1990.
Cloning, organization, and expression of the bioluminescence genes of Xenorhabdus luminescens.
J. Bacteriol.
172:5767-5773 |
| 13. |
Gallagher, D. S., Jr.,
A. M. Ryan,
G. Diamond,
C. L. Bevins, and J. E. Womack.
1995.
Somatic cell mapping of -defensin genes to cattle syntenic group U25 and fluorescence in situ localization to chromosome 27.
Mamm. Genome
6:554-556[Medline].
|
| 14. | Ganz, T., and R. I. Lehrer. 1995. Defensins. Pharmacol. Ther. 66:191-205[Medline]. |
| 15. | Gibson, K. F., and S. Phadke. 1994. Intracellular distribution of lysozyme in rat alveolar type II epithelial cells. Exp. Lung Res. 20:595-611[Medline]. |
| 16. |
Goldman, M. J.,
M. G. Anderson,
E. D. Stolzenberg,
P. U. Kari,
M. Zasloff, and J. M. Wilson.
1997.
Human -defensin-1 is a salt-sensitive antibiotic in lung that is inactivated in cystic fibrosis.
Cell
88:1-9[Medline].
|
| 17. | Harder, J., J. Bartels, E. Christophers, and J.-M. Schroder. 1997. A peptide antibiotic from human skin. Nature 387:861-862[Medline]. |
| 18. |
Harder, J.,
R. Siebert,
Y. Zhang,
P. Matthiesen,
E. Christophers,
B. Schlegelberger, and J.-M. Schroder.
1997.
Mapping of the gene encoding human -defensin-2 (DEFB2) to chromosome region 8p22-p23.1.
Genomics
46:472-475[Medline].
|
| 19. | Hiemstra, P. S., R. J. Maassen, J. Stolk, R. Heinzel-Weiland, G. J. Steffens, and J. H. Dijkman. 1996. Antibacterial activity of antileukiprotease. Infect. Immun. 64:4520-4524[Abstract]. |
| 20. | Huttner, K. M., D. J. Brezinski-Caliguri, M. M. Mahoney, and G. Diamond. 1998. Antimicrobial peptide expression is developmentally regulated in the ovine gastrointestinal tract. J. Nutr. 128:297S-299S. |
| 21. |
Huttner, K. M.,
C. A. Kozak, and C. L. Bevins.
1997.
The mouse genome encodes a single homolog of the antimicrobial peptide human -defensin 1.
FEBS Lett.
413:45-49[Medline].
|
| 22. | Huttner, K. M., M. R. Lambeth, H. R. Burkin, D. J. Burkin, and T. E. Broad. 1998. Localization and genomic organization of sheep antimicrobial peptide genes. Gene 206:85-91[Medline]. |
| 23. |
Liu, L.,
L. Wang,
H. P. Jia,
C. Zhao,
H. H. Q. Heng,
B. C. Schutte,
P. B. McCray, Jr., and T. Ganz.
1998.
Structure and mapping of the human -defensin HBD-2 gene and its expression at sites of inflammation.
Gene
222:237-244[Medline].
|
| 24. |
Liu, L.,
C. Zhao,
H. H. Q. Heng, and T. Ganz.
1997.
The human -defensin-1 and -defensins are encoded by adjacent genes: two peptide families with differing disulfide topology share a common ancestry.
Genomics
43:316-320[Medline].
|
| 25. | Longo, C., D. Tyler, and R. K. Mallampalli. 1997. Sphingomyelin metabolism is developmentally regulated in rat lung. Am. J. Respir. Cell Mol. Biol. 16:605-612[Abstract]. |
| 26. |
McCray, P. B., Jr., and L. Bentley.
1997.
Human airway epithelia express a -defensin.
Am. J. Respir. Cell Mol. Biol.
16:343-349[Abstract].
|
| 27. |
Miller, M.
1987.
The susceptibility to lysozyme of beta-lactamase-producing and non-producing derivatives of Staphylococcus aureus strain 1030.
J. Med. Microbiol.
23:127-132 |
| 28. | Morrison, G. M., D. J. Davidson, F. M. Kilanowski, D. W. Borthwick, K. Crook, A. I. Maxwell, J. R. W. Govan, and J. R. Dorin. 1998. Mouse beta defensin-1 is a functional homolog of human beta defensin-1. Mamm. Genome 9:453-457[Medline]. |
| 29. | Nishimura, D. Y., R. E. Swiderski, W. L. Alward, C. C. Searby, S. R. Patil, S. R. Bennet, A. B. Kanis, J. M. Gastier, E. M. Stone, and V. C. Sheffield. 1998. The forkhead transcription factor gene FKHL7 is responsible for glaucoma phenotypes which map to 6p25. Nat. Genet. 19:140-147[Medline]. |
| 30. | Reynolds, H. Y. 1997. Integrated host defense against infections, p. 2353-2365. In H. Y. Reynolds (ed.), The lung. Raven Press, Ltd., New York, N.Y. |
| 31. |
Schonwetter, B. S.,
E. D. Stolzenberg, and M. A. Zasloff.
1995.
Epithelial antibiotics induced at sites of inflammation.
Science
267:1645-1648 |
| 32. |
Singh, P. K.,
H. P. Jia,
K. Wiles,
J. Hesselberth,
L. Liu,
B. D. Conway,
E. P. Greenberg,
E. V. Valore,
M. J. Welsh,
T. Ganz,
B. F. Tack, and P. B. McCray, Jr.
1998.
Production of -defensins by human airway epithelia.
Proc. Natl. Acad. Sci. USA
95:14961-14966 |
| 33. | Smith, J. J., S. M. Travis, E. P. Greenberg, and M. J. Welsh. 1996. Cystic fibrosis airway epithelia fail to kill bacteria because of abnormal airway surface fluid. Cell 85:229-236[Medline]. |
| 34. | Snyder, J. M. 1991. The biology of the surfactant-associated proteins, p. 105-126. In J. Bourbon (ed.), Pulmonary surfactant: biochemical, functional, regulatory and clinical concepts. CRC Press, Inc., Boca Raton, Fla. |
| 35. | Stein, L., D. Kruglyak, D. Slonim, and E. Lander. 1995. "RHMAPPER" software. Whitehead Institute/Massachusetts Institute of Technology Center for Genome Research. Available at http://www.genome.wi.mit.edu/ftp/pub/software/rhmapper and via anonymous ftp to ftp.genome.wi.mit.edu, directory /pub/software/rhmapper. |
| 36. |
Tarver, A. P.,
D. P. Clark,
G. Diamond,
J. P. Russell,
H. Erdjument-Bromage,
P. Tempst,
K. S. Cohen,
D. E. Jones,
R. W. Sweeney,
M. Wines,
S. Hwang, and C. L. Bevins.
1998.
Enteric -defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
Infect. Immun.
66:1045-1056 |
| 37. |
Tchepichev, S.,
J. Ueda,
C. Canessa,
B. C. Rossier, and H. O'Brodovich.
1995.
Lung epithelial Na channel subunits are differentially regulated during development and by steroids.
Am. J. Physiol.
269:C805-C812 |
| 38. |
Valore, E. V.,
C. H. Park,
A. J. Quayle,
K. R. Wiles,
P. B. McCray, Jr., and T. Ganz.
1998.
Human -defensin-1, an antimicrobial peptide of urogenital tissues.
J. Clin. Investig.
101:1633-1642[Medline].
|
| 39. |
Watanabe, S.,
K. Matsushita,
J. B. Stokes, and P. B. McCray, Jr.
1998.
Developmental regulation of epithelial sodium channel subunit mRNA expression in rat colon and lung.
Am. J. Physiol.
275:G1227-G1235 |
| 40. | Welsh, M. J., T. F. Boat, L.-C. Tsui, and A. L. Beaudet. 1995. Cystic fibrosis, p. 3799-3876. In C. R. Scriver, A. L. Beaudet, W. S. Sly, and D. Valle (ed.), The metabolic and molecular basis of inherited disease. McGraw-Hill, Inc., New York, N.Y. |
| 41. |
Whitsett, J. A.,
L. M. Nogee,
T. E. Weaver, and A. D. Horowitz.
1995.
Human surfactant protein B: structure, function, regulation, and genetic disease.
Physiol. Rev.
75:749-757 |
| 42. | Wilcox, J. N. 1993. Fundamental principles of in situ hybridization. J. Histochem. Cytochem. 41:1725-1733[Abstract]. |
| 43. |
Zhang, G.,
H. Wu,
J. Shi,
T. Ganz,
C. R. Ross, and F. Blecha.
1998.
Molecular cloning and tissue expression of porcine -defensin-1.
FEBS Lett.
424:37-40[Medline].
|
| 44. |
Zucht, H. D.,
J. Grabowsky,
M. Schrader,
C. Liepke,
M. Jurgens,
P. S. Knappe, and W. G. Forssmann.
1998.
Human -defensin-1: a urinary peptide present in variant molecular forms and its putative functional implication.
Eur. J. Med. Res.
3:315-323[Medline].
|
This article has been cited by other articles:
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»