Previous Article | Next Article 
Infection and Immunity, June 2000, p. 3657-3666, Vol. 68, No. 6
0019-9567/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
An OmpA-Like Protein from Acinetobacter
spp. Stimulates Gastrin and Interleukin-8 Promoters
Ernest
Ofori-Darko,1
Yana
Zavros,2
Gabriele
Rieder,1
Susan A.
Tarlé,2
Mary
Van
Antwerp,2 and
Juanita L.
Merchant1,2,3,*
Howard Hughes Medical
Institute2 and Departments of Internal
Medicine1 and
Physiology,3 University of Michigan,
Ann Arbor, Michigan
Received 14 December 1999/Returned for modification 21 February
2000/Accepted 15 March 2000
 |
ABSTRACT |
Bacterial overgrowth in the stomach may occur under conditions of
diminished or absent acid secretion. Under these conditions, secretion
of the hormone gastrin is elevated. Alternatively, bacterial factors
may directly stimulate gastrin. Consistent with this hypothesis, we
found that mice colonized for 2 months with a mixed bacterial culture
of opportunistic pathogens showed an increase in serum gastrin. To
examine regulation of gene expression by bacterial proteins, stable
transformants of AGS cells expressing gastrin or interleukin-8 (IL-8)
promoters were cocultured with live organisms. Both whole-cell
sonicates and a heat-stable fraction were also coincubated with the
cells. A level of 108 organisms per ml stimulated both the
gastrin and IL-8 promoters. Heat-stable proteins prepared from these
bacterial sonicates stimulated the promoter significantly more than the
live organism or unheated sonicates. A 38-kDa heat-stable protein
stimulating the gastrin and IL-8 promoters was cloned and found to be
an OmpA-related protein. Immunoblotting using antibody to the OmpA-like
protein identified an Acinetobacter sp. as the bacterial
species that expressed this protein and colonized the mouse stomach.
Moreover, reintubation of mice with a pure culture of the
Acinetobacter sp. caused gastritis. We conclude that
bacterial colonization of the stomach may increase serum gastrin levels
in part through the ability of the bacteria to produce OmpA-like
proteins that directly stimulate gastrin and IL-8 gene expression.
These results implicate OmpA-secreting bacteria in the activation of
gastrin gene expression and raise the possibility that a variety of
organisms may contribute to the increase in serum gastrin and
subsequent epithelial cell proliferation in the hypochlorhydric stomach.
 |
INTRODUCTION |
Colonization by aerobic and anerobic
flora occurs in the stomach with increasing pH (45) and may
be the result of increasing age, malnutrition, or iatrogenically
induced achlorhydria, e.g., H2 receptor blockade or
proton pump inhibitor administration. With the exception of stress
ulcer treatment, the bacterial flora present under conditions of
hypochlorhydria has been poorly studied. More importantly, chronic
achlorhydria is a risk factor for gastric cancer (42).
Patients in intensive care units often have a gastric pH of >3 due to
the routine use of antacids, proton pump inhibitors, or H2
receptor antagonists to prevent stress ulcers. An increase in gastric
pH permits colonization of the stomach with opportunistic pathogens
that contribute to the development of nosocomial pneumonia (19). Acinetobacter baumannii, Klebsiella
pneumoniae, and Pseudomonas spp. are the predominant
strains cultured from the relatively alkaline stomachs of ventilated
patients (19) and are implicated in nosocomial respiratory
infections (10). In a previous study, which examined
oropharyngeal and gastric colonization using DNA genomic analysis,
gastric colonization occurred regardless of the pH, which ranged from
2.8 to 5.7. Antacids were not used, and H2 receptor
antagonists were used occasionally. Interestingly, A. baumannii was responsible for 30 nosocomial pneumonias in these ventilated patients despite the use of broad-spectrum antibiotics, e.g., amoxicillin and aminoglycosides.
Gastrin regulates acid secretion and is a growth factor for the oxyntic
mucosa (11). Elevated serum gastrin levels stimulate parietal cell proliferation and acid secretion. Due to the normal feedback regulation of gastrin by acid, achlorhydria is a potent activator of gastrin gene expression (7). Therefore,
overexpression of gastrin has also been implicated as a risk factor for
gastric cancer (47). Since achlorhydria predisposes the
stomach to both colonization by a variety of bacteria and
hypergastrinemia, we queried whether the two conditions might be
related. Thus, the goal of the present study was to identify candidate
virulence factors in gastric bacterial flora that might both stimulate
gastrin promoter activity and increase serum gastrin levels.
A microaerophilic culture consisting of Acinetobacter,
Pseudomonas, and Corynebacterium spp. was
inoculated into mouse stomachs for 2 to 6 months, after which an
increase in serum gastrin levels was observed within 2 months. In
addition to the effect on gastrin, the effect of these organisms on
interleukin-8 (IL-8) gene expression was studied in a cell culture
model, since it has been shown that Helicobacter pylori
colonization stimulates production of CXC cytokines (e.g., IL-8) from
the gastric mucosa (24). This cytokine class exhibits potent
chemotactic effects that contribute to the inflammatory infiltrate
(31). We used a human gastric cell line stably transfected
with the human gastrin or IL-8 promoter to identify putative virulence
factors produced by these organisms. We observed that live cultures of
the bacteria were able to stimulate gastrin and IL-8 promoter activity
in a dose-dependent manner and correlated the activity with the major
protein in the heat-stable fraction. This protein was N-terminally
sequenced and then cloned and found to be related to the major outer
membrane protein found in most gram-negative pathogens, called OmpA. Of
the organisms cultured from the mouse stomach, the OmpA-like protein
was expressed exclusively in the Acinetobacter strain.
Therefore, the OmpA-like protein appears to be an important bacterial
factor capable of stimulating gastrin and IL-8 gene expression.
 |
MATERIALS AND METHODS |
Reagents.
The IL-8 luciferase reporter construct, a gift
from H. C. Reinecker (Massachusetts General Hospital, Boston),
contains the first 497 bp of the human IL-8 promoter as described by
Mukaida et al. (32) in pGL3 basic (Promega).
A mixed stock of Acinetobacter, Pseudomonas, and
Corynebacterium spp. was used to inoculate blood agar plates
consisting of 5% sterile horse blood in
Campylobacter-selective agar (Difco) supplemented with 5%
(vol/vol) sterile horse blood (Rockland). The plates were incubated for
5 days in a humidified microaerophilic chamber to mimic the stomach
environment (BBL Gas System, with CampyPak Plus packs
[Fisher]). The bacteria recovered from the mice and cultured under
these conditions were urease, catalase, and oxidase positive. To
document the absence of any H. pylori species, the culture
was plated onto blood agar plates supplemented with multiple
antibiotics (amphotericin B [Fungizone], 1.5 ml/liter; vancomycin,
6.67 mg/ml; polymyxin B sulfate, 0.22 mg/ml; bacitracin, 13.33 mg/ml;
and nalidixic acid, 2.14 mg/ml). No growth was observed. Whole-cell
sonicates (WCS) were prepared by removing bacterial growth with a
cotton swab, suspending it in ice-cold phosphate-buffered saline (PBS)
(10 ml per 150-mm plate), and then pelleting the bacteria collected in
15-ml conical tubes at 3,000 rpm for 10 min at 4°C. The washed
bacterial pellet was resuspended in PBS at a final concentration of
108 organisms/ml. Five 15-s bursts at 30% power output
were used to disrupt the bacterial wall at 4°C. Heated supernatants
(HS) were prepared from the WCS by incubating the sonicate for 15 min at 80°C and then pelleting denatured protein at 10,000 rpm for 15 min. Fifty micrograms of either WCS or HS was added to each 35-mm well
of a six-well plate. Luciferase activity normalized to protein was
analyzed 6 h later after incubating cells with live organisms or
3 h later after incubation with bacterial extracts. Protein
concentrations were determined by the method of Bradford (6). The results were expressed as induction relative to the untreated controls. The proteins in the HS were size fractionated in a
2-ml-volume Centricon filter (Millipore) with a membrane size limit of
10 kDa according to the manufacturer's instructions.
Bacterial colonization in mice.
C57BL/6 (Charles River) mice
underwent gastric intubation with a catheter four times over four
consecutive days with 100 µl of bacterial suspension containing
108 organisms in PBS. Control animals were treated with a
suspension of 108 Escherichia coli DH5
organisms. The animals were subjected to fasting overnight and then
sacrificed 2 or 6 months later. The stomach was fixed in 4%
paraformaldehyde diluted in PBS and paraffin embedded. Three-micrometer
sections were prepared, deparaffinized, and stained with hematoxylin
and eosin. Acinetobacter colonization was verified by
reculturing stomach homogenates. Reintubation of mice with a pure
subculture of the Acinetobacter sp. was accomplished as
described above after twice-daily oral administration of streptomycin (0.2 ml of a 5-mg/ml stock solution per intubation) over 5 days to
reduce the endogenous microbial flora in the stomach. Serum gastrin
levels were determined by radioimmunoassay performed by the University
of Michigan Peptide Center.
Cell culture.
AGS cells (derived from a human gastric
adenocarcinoma) (1) were purchased from the American Type
Culture Collection and cultured in Dulbecco's modified Eagle's medium
(Gibco-BRL) containing 10% fetal calf serum, 100 µg of penicillin
per ml, and 100 µg of streptomycin per ml in a humidified atmosphere
of 5% CO2 and 95% air in 35-mm six-well culture dishes at
37°C. The cells were stably transfected with the 240 gastrin
luciferase reporter construct (240 GasLuc), selected in G418
(Gibco-BRL), and pooled as described previously (17). The
240 GasLuc construct contains 240 bp of the human gastrin promoter and
the first exon ligated upstream of the luciferase reporter in pGL2
basic (Promega). Calcium phosphate coprecipitation (5 Prime-3 Prime)
was used to perform stable transfections into AGS cells. The cells were
incubated for 48 h in Ham's F-12 nutrient mixture containing 100 µg of penicillin per ml and 100 µg of streptomycin (Gibco-BRL) per
ml without serum prior to treatment with 10 nM epidermal growth factor
(EGF), 20 ng of IL-1
per ml, or 50 µg of bacterial extracts.
Protease digestion.
Staphylococcus aureus V8 and
trypsin proteases were purchased from Sigma. Three hundred micrograms
of the HS was incubated at 37°C with 7,500 U of each protease. A
second aliquot of the proteases was added after 3 h, and the
incubation was allowed to proceed overnight. Protease activity was
inactivated by heating the proteins to 80°C for 15 min and pelleting
the denatured protein. Digestion of the protein mixture in the HS was
confirmed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis
(SDS-PAGE) and Coomassie blue staining. Fifty micrograms of the digest
was added to the luciferase-expressing stable transformants to
determine if the activity in the HS was protease sensitive. There was
no morphologic change in the cells after incubation with the protein digest. Protein concentrations were determined by the method of Bradford (6).
Protein elution.
Bacterial proteins from the HS were
resolved on a 4 to 12% gradient gel (Novex) and visualized by Sypro
Orange (Molecular Probes). The 38-, 130-, and 15-kDa proteins were
excised, minced, and then electroeluted overnight at 10 mA per sample
in a Bio-Rad Electro-Eluter (Model 422) in the presence of 25 mM
Tris-192 mM glycine-0.1% SDS. The SDS was removed by continuing the
elution for an additional hour in the absence of SDS. Fifty microliters of the eluted protein was added per 35-mm well of a six-well plate.
Peptide analysis.
SDS-PAGE was carried out on a 4 to 12%
gradient gel (Novex), and the gel was stained with Coomassie blue dye.
Edman degradation analysis of the N-terminal sequence was carried out
by the University of Michigan Protein Core after transferring resolved
proteins to polyvinylidene difluoride (PVDF) paper. Thirty N-terminal
amino acids were sequenced from the 38-kDa protein isolated from the HS
and bacterial wash fraction
(GVTVTPLMLGYTFQDTQHNNNGNDGELTSS). In addition, a
cyanogen bromide (CNBr) digest of the 38-kDa protein was resolved on an
SDS-10% polyacrylamide gel and transferred to PVDF for amino acid
sequencing by Edman degradation. N-terminal sequencing of the 9-kDa
fragment (ELRVFFDTNKSNIKDOYKPEIAKVAEKLVE) was used to design the reverse primer. The forward primer
[5' ATG (TC)T(CAGT) GGA TAT ACA TTT CAG GAC AC(CAGT)
CA(AG) CA(TC) AA(TC) AA(TC) AAT] was a degenerate
oligonucleotide sequence based upon the underlined N-terminal amino
acid sequence from the full-length 38-kDa protein. The reverse primer
was a degenerate oligonucleotide sequence based upon amino acid
sequence from the 9-kDa peptide [5' (AG)CT (TC)TT (AG)TT
(CAGT)GT (AG)TC (AG)AA (AG)AA (CAGT)AC]. The primers
produced a 600-bp fragment from genomic DNA. This fragment was labeled
using the Rediprime II kit (Stratagene) and used to screen a genomic
bacterial library.
Genomic library screen.
The library in lambda ZAP II
(Stratagene) was prepared from genomic DNA extracted from the bacterial
culture mixture using a genomic DNA extraction kit (Qiagen). A total of
107 plaques of the unamplified library were screened. The
Bluescript plasmid containing genomic inserts were excised with helper
phage and sequenced. Of the six positive clones identified as
containing 0.4- to 1.6-kb inserts, all six were partially sequenced,
and it was confirmed that they contained the same overlapping sequence. Two of the overlapping clones containing the most distal 5' and 3'
sequences were completely sequenced to produce a 1.7-kb genomic contig
for the ompA locus.
Antibody production and immunoblotting.
A synthetic peptide
(250 micromol) that corresponded to the C terminus (CGSRTVLAEQPVAQ) of
the OmpA-like protein was prepared by the University of Michigan
Peptide Core and conjugated to keyhole limpet hemocyanin. Rabbits were
injected monthly with 250 to 500 µg of the peptide (Rockland) and
analyzed by Western blotting using the HS as the antigen. An
immunoglobulin fraction was prepared from both the immune and the
preimmune sera using protein A-agarose (Santa Cruz) prior to use. To
detect the OmpA on immunoblots, protein transferred to PVDF membrane
was blocked for 1 h with 0.5× Uni-Block (Analytical Genetic
Testing Center, Inc.) and then incubated with a 1:10,000 dilution of
the immunoglobulin fraction for 1 h at 25°C. A 1:1,000 dilution
of the secondary antibody was used, and the complexes were detected by
enhanced chemiluminescence (SuperSignal; Pierce).
Recombinant protein.
To produce recombinant OmpA protein,
the cDNA was amplified from the Bluescript plasmid using a forward
primer (5' GGCGTAACTGTTACTCCGTTGATG [GVTV form minus
putative signal peptide] or 5' ATGGCCTATTGCGGGCTTGAGCTT [full-length form with putative signal peptide]) and a reverse primer (5' TTGAGCAACTGGTTGTTCAGCTAAAACAG). The amplimer was
then inserted into the EcoRI site of the TA cloning vector
(Invitrogen) and sequenced to determine the orientation. The
EcoRI fragment was excised from the TA cloning vector and
directionally subcloned into the EcoRI site of the pET
vector (Novagen). The orientation was verified by restriction analysis
and sequencing. The resulting expression vector was used to transform
BL21(DE) cells and produce recombinant protein. The recombinant protein
was induced at 37°C with 1 mM IPTG
(isopropyl-
-D-thiogalactopyranoside) for 3 to 4 h
and then purified from the bacterial pellet (inclusion bodies) according to the method described by Yang et al. (49).
Briefly, the bacterial pellet obtained after sonication was suspended
in 50 mM Tris-HCl, pH 8.0, in 0.5% Triton X-100-10 mM EGTA. It was then centrifuged at 20,000 × g for 30 min at 4°C.
The pellet was washed in 50 mM Tris-HCl, pH 8.0, containing 0.1% SDS
and resuspended in 50 mM Tris-HCl, pH 8.0, in 0.5% Triton X-100-10 mM
EGTA. To this suspension, a final concentration of 6 M urea was added; the suspension was heated to 60°C for 30 min and then dialyzed at
4°C against 50 mM Tris-HCl, pH 8.0, overnight. Due to low solubility, this suspension was resolved on an SDS-polyacrylamide gel as described for the eluted protein above prior to addition of the AGS cell cultures.
Nucleotide sequence accession number.
The GenBank accession
no. for the Acinetobacter ompA genomic sequence is AF132598.
 |
RESULTS |
Increase in serum gastrin stimulated by gastric flora.
Mice
were infected with the mixture of opportunistic pathogens and then
sacrificed after 2 months. The stomachs were examined by
immunohistochemistry and revealed mucosal and submucosal infiltrates in
the corpus and antrum. Serum gastrin levels were elevated in infected
mice compared with control mice by approximately fourfold (14.2 ± 4.0 [standard error of the mean] fmol/ml, n = 3,
versus 3.2 ± 1.1 [standard error of the mean] fmol/ml,
n = 3, respectively).
Regulation of the gastrin promoter by bacterial coculture.
To
examine whether bacterial contact directly stimulates gastrin gene
expression, increasing concentrations of the bacterial mixture used to
infect the mice were cocultured with stable transformants of AGS cells
that express the human gastrin reporter construct. The effect of the
organisms on IL-8 promoter activity was also examined. The results
demonstrated a dose-dependent increase in both gastrin and IL-8
promoter activity with increasing concentrations of bacteria (Fig.
1) and demonstrated that live organisms
were capable of stimulating gastrin as well as IL-8 promoter activity to an extent that correlated with their ability to increase serum gastrin levels in infected mice.

View larger version (36K):
[in this window]
[in a new window]
|
FIG. 1.
Coculture of the bacterial culture with AGS
transformants stimulates gastrin and IL-8 promoters. Increasing amounts
of the organisms were cocultured with stable transformants of AGS cells
expressing gastrin (solid bars) or IL-8 (stippled bars) promoter
constructs. One optical density (OD) unit equals 2.4 × 108 organisms. EGF (E) and IL-1 were used as positive
inducers of the gastrin and IL-8 promoters, respectively. The basal
luciferase activity for these constructs was ~7,000 light units per
µg of protein constructs for the gastrin promoter and ~50,000 light
units per µg of protein for the IL-8 promoter. The mean of the
relative induction ± standard error for at least four experiments
is shown.
|
|
Identifying a protein fraction that stimulates promoter
activity.
To isolate a bacterial subfraction containing the
activity, the proteins recovered from the bacterial wash as well as the WCS were heated and then separated into soluble and insoluble fractions
(Fig. 2A). Surprisingly, the substance
stimulating an increase in promoter activity partitioned with the
heat-soluble fraction (Fig. 2B). This result raised several
possibilities
that the activating substance was not protein or that
heating removed heat-labile inhibitory substances. A third
consideration was that heating induced a conformational change in the
protein such that it was more active. To address the first two
possibilities, the heat-stable supernatant was resolved on a denaturing
gel (Fig. 2C). A striking finding was the similarity between the
heat-stable bacterial wash and the heat-stable fraction isolated from
the WCS (Fig. 2C, lanes 2 and 4). The most abundant protein in the heat-stable supernatant prepared from the WCS was a 38-kDa protein which also appeared in the heated wash. Much of the protein was heat
labile and was rendered insoluble. Thus, the higher specific activity
may be related to the removal of an inhibitor.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 2.
The bacterial fraction stimulating the gastrin promoter
is heat stable. (A) Fractionation scheme for the bacterial mixture. The
PBS wash (Wash), WCS, and supernatant from the WCS were heated to
80°C for 15 min. The HS represents the activity after pelleting
insoluble protein (Pellet) at 10,000 rpm for 15 min. (B) Fifty
micrograms of the various fractions was used to stimulate stable
transformants that express the human gastrin reporter construct. The
relative induction ± standard error for at least four experiments
is shown. C, control. (C) The indicated fractions were resolved on a 4 to 12% gradient gel and then stained with Coomassie blue dye. Lane M
shows molecular mass markers. Ht, heated.
|
|
To examine whether the activating material was of protein origin or was
a small organic molecule or peptide, size fractionation
was performed
using Centricon spin columns set to exclude masses
of approximately 10 to 15 kDa (Fig.
3A). The results shown in
Fig.
3B demonstrate that most of the activity segregated with
the
higher-molecular-mass proteins (>15 kDa), supporting the argument
that
the activating factor was not a small molecule. We found
that a minimum
amount of activity segregated with the low-molecular-weight
material
and concluded that this may represent either peptides
or proteolytic
fragments of the higher-molecular-weight proteins.
To demonstrate
directly that the factor was a protein, the HS
was treated with
S. aureus V8 or trypsin proteases (Fig.
4). Indeed,
both proteases abolished the
expected induction of both promoters
by the heat-stable fraction.
Therefore, we concluded that the
gram-negative organisms produce
soluble, heat-stable proteins
capable of stimulating gene expression.

View larger version (51K):
[in this window]
[in a new window]
|
FIG. 3.
The bacterial activity segregates with a protein of >15
kDa. (A) The Centricon fractions greater or less than 15 kDa were
prepared from the HS and then resolved on an SDS-4 to 12%
polyacrylamide gradient gel. Lane 1, WCS; lane 2, protein filtrate with
molecular mass less than 15 kDa (<15); lane 3, protein retained on the
Centricon filter, primarily >15 kDa (>15). (B) Activity of the
gastrin promoter after stimulation of the stable transformants with 10 nM EGF or with 50 µg of the HS fraction or the >15-kDa or <15-kDa
protein fractions from the Centricon filter. Shown is the mean of two
experiments. Con, control.
|
|

View larger version (20K):
[in this window]
[in a new window]
|
FIG. 4.
The activity in the HS is protease sensitive. The HS was
digested with either V8 protease (V8) or trypsin (T) overnight. Fifty
micrograms of the HS before and after protease digestion was incubated
with the stable transformants expressing the human gastrin (240 GasLuc)
or IL-8 (IL-8 Luc) promoter for 3 h prior to the assay for
luciferase activity, and values were then expressed as relative
induction. Treatment of the gastrin and IL-8 promoters with 10 nM EGF
and 4 ng of IL-1 per ml, respectively, is shown. The mean ± standard error is shown for three independent experiments. *,
P < 0.05. C, control.
|
|
Transcriptional activity attributed to 38-kDa protein.
To
determine if the activity resided with one or more of the abundant
heat-stable proteins, three protein bands including the abundant 38-kDa
protein were eluted from the SDS gel. Equivalent amounts of eluted
protein verified by SDS-PAGE were tested on the stable transformants
expressing the gastrin and IL-8 promoters. The results shown in Fig.
5 demonstrate that much of the induction was mediated by the 38-kDa heat-stable protein in contrast to the 130- and 15-kDa protein bands. However, since other proteins in the
heat-stable fraction were not evaluated, we could not eliminate the
possibility that other proteins in the HS fraction may also be capable
of stimulating the promoters.

View larger version (33K):
[in this window]
[in a new window]
|
FIG. 5.
Eluted 38-kDa protein isolated from the HS stimulates
the gastrin and IL-8 promoters. (A) Coomassie blue-stained SDS-PAGE of
protein bands (lane 1, 38 kDa; lane 2, 130 kDa; lane 3, 15 kDa) eluted
from the gel and used in reporter gene assays shown in panel B. (B)
Relative induction of the gastrin (240 GasLuc) and IL-8 (IL-8 Luc)
promoter constructs stably expressed in AGS cells after treatment with
the eluted 38 (solid bars)-, 130 (stippled bars)-, and 15 (hatched
bars)-kDa proteins. Eluted gel (G; open bars) without protein was used
as the control for the eluted protein bands. Shown are results
representative of three experiments performed in triplicate.
|
|
Cloning of an ompA-like gene.
Since a significant
amount of the promoter activity was attributed to the 38-kDa protein,
the eluted band was submitted for peptide sequencing. N-terminal
sequencing of the first 30 amino acids showed 80% similarity to outer
membrane protein CD from a respiratory pathogen, Moraxella
catarrhalis (Fig. 6). CNBr cleavage produced several internal peptides that were subsequently sequenced. The smaller, 9-kDa fragment was 80% identical to a sequence within the
C terminus of the same Moraxella protein (Fig. 6). Thus, we concluded that the bacterial factor may also be an outer membrane protein. Degenerate PCR primers were designed from the two N- and
C-terminal peptides and produced a 600-bp amplimer with genomic DNA
isolated from the bacterial culture. The resulting amplimer was
subcloned, sequenced, and translated to confirm overlap with the
N-terminal and C-terminal peptides and one additional 21-kDa internal
CNBr peptide fragment (Fig.
7A).

View larger version (49K):
[in this window]
[in a new window]
|
FIG. 6.
N-terminal sequence of 38-kDa protein related to
Moraxella outer membrane protein CD. Lanes 1 to 3, Coomassie
blue-stained gel; lanes 4 and 5, Coomassie blue-stained PVDF membrane.
Lanes 1 and 4, molecular mass markers; lane 2, excised 38-kDa protein;
lane 3, HS; lane 5, CNBr digest resolved on a 4 to 12% SDS gradient
gel. The N-terminal sequences from the full-length 38-kDa protein and
the 9-kDa CNBr fragment were compared to the M. catarrhalis
CD protein (underlined). Asterisks indicate the CNBr fragments
N-terminally sequenced.
|
|




View larger version (35302843K):
[in this window]
[in a new window]
|
FIG. 7.
Sequence of a novel OmpA-like protein. (A) PCR primers
were designed from the N-terminal peptide sequences of the full-length
protein and 9-kDa CNBr fragment and used to amplify genomic DNA
isolated from bacterial strains. The forward ( ) and reverse ( )
primers are indicated. The italicized sequences are the residues
sequenced from the full-length 38-kDa peptide and 9-kDa CNBr fragments.
The underlined residues were sequenced from the N terminus of the
21-kDa CNBr fragment. (B) ompA-like gene locus with
translation. The in-frame upstream TAA stop codons are underlined. The
dotted underline indicates the Shine-Dalgarno sequence. The putative
signal sequence is double underlined. (C) Comparison of M. catarrhalis CD protein (M. cat) with the OmpA-like
protein (OmpA). Plus signs indicate amino acid similarity;
dashes indicate sequence gaps.
|
|
This 600-bp fragment was then used to screen a genomic library created
from genomic DNA. Two of the six overlapping clones
were sequenced
completely, creating a 1.7-kb locus containing
the 1.1-kb coding
sequence (Fig.
7B). Translation of the open
reading frame based upon
the most N-terminal peptide revealed
two TAA stop codons 78 bp upstream
of a putative ATG start codon.
Another in-frame ATG was identified 57 bp further upstream. However,
this second ATG was not preceded by a
Shine-Dalgarno sequence.
Thus, the predicted ATG was preceded by a
perfect Shine-Dalgarno
sequence (TGGAGGAT) 6 bp upstream of
the translational start codon
(
18). The additional
21-amino-acid sequence upstream of the
original peptide beginning with
GVTV was 45% identical to the
E. coli OmpA signal sequence
and the leader sequence of other
secreted bacterial proteins
(
38). Amino acids 22 to 262 were
similar to transmembrane
domains of OmpA (
29). Thus, overall
the translated protein
contained 349 amino acids corresponding
to a molecular mass of 38 kDa
(35 kDa without the N-terminal leader
sequence) and a pI of 4.76. There
were no cysteine residues present
within the entire open reading frame.
These features are consistent
with the abundant heat-modifiable class
of outer membrane proteins,
called OmpA, found in most gram-negative
bacteria. Figure
7C shows
the homology between the
Moraxella
outer membrane CD OmpA-like
protein and the newly cloned OmpA-like
protein.
Recombinant OmpA-like protein stimulates gastrin and IL-8 promoter
activity.
To demonstrate that the recombinant OmpA-like protein
stimulated gastrin and IL-8 gene expression, the recombinant protein was prepared from E. coli protein-overexpressing
transformants and tested on the stably transfected AGS cells. The
results demonstrate that the recombinant OmpA-like protein stimulated
the gastrin and IL-8 promoters (Fig. 8).
The difference between the activity of the HS and that of the
recombinant protein was due to the lower concentration of protein
eluted from the gel. To demonstrate that the OmpA-like protein was the
major protein responsible for the activity in the HS, antibody
neutralization experiments were performed. Antibody raised against the
C terminus of the OmpA-like protein specifically blocked the activation
of both the gastrin and IL-8 promoters mediated by the HS, whereas the
preimmune antibodies did not inhibit activity in the HS (Fig.
9).

View larger version (35K):
[in this window]
[in a new window]
|
FIG. 8.
Recombinant OmpA-like protein stimulates gastrin and
IL-8 promoters. HS or two forms (minus signal sequence [GVTV] and
full-length protein [FL]) of the recombinant OmpA-like protein eluted
from SDS-polyacrylamide gels were incubated with AGS cells stably
transfected with the 240 GasLuc or IL-8 Luc reporter construct.
"Vector" indicates bacterial extract prepared as described for the
recombinant protein except that the bacteria were transformed with the
empty pET vector. "Media" indicates the AGS culture medium
described in Materials and Methods. The results are the means and
ranges of two independent experiments performed in duplicate and
plotted as relative induction.
|
|

View larger version (25K):
[in this window]
[in a new window]
|
FIG. 9.
Neutralization of HS activity with OmpA-like protein
antiserum. HS alone (20 µg) or in the presence of 2 µg of antibody
raised against the OmpA-like protein (HS + Imm) was incubated for
4 h prior to precipitating the complexes with protein A/G. The
resulting supernatant was then added to the stable AGS transformants.
The same concentration of immunoglobulin G prepared from the preimmune
serum was used as a negative control (HS + PI). In addition, the
immune (Imm) or preimmune (PI) immunoglobulin G fractions alone were
added to the stable transformants in the absence of the HS. The results
are the means and ranges of two independent experiments performed in
duplicate and plotted as percent inhibition relative to the HS.
|
|
The OmpA-like protein is expressed only in
Acinetobacter species.
Since the original bacterial
suspension contained at least two other bacterial species, the mixture
was subcultured and typed. Typing of the bacterial species was
performed using 16S ribosome primers, and the sequences were compared
to database entries (28). Further characterization was
performed using morphology, culture characteristics, and enzymatic
analysis. Antibody raised to the cloned OmpA-like protein was used on
an immunoblot to identify the bacterial strain expressing the cloned
factor. The results shown in Fig. 10
demonstrate that the Acinetobacter sp. was the only
bacterial strain isolated that expressed the cloned OmpA-like protein.
To verify that this species was present in the inoculated mice, Western
blotting was performed on the bacteria cultured from the mice. The
results shown in Fig. 11 demonstrate
that the same OmpA-like protein cloned was expressed in a subculture of Acinetobacter from infected mouse stomachs. The antibody did
not cross-react with HS from a Pseudomonas sp.

View larger version (93K):
[in this window]
[in a new window]
|
FIG. 10.
The OmpA-like protein is expressed in
Acinetobacter spp. HS from subcultures of
Acinetobacter, Pseudomonas, and a
Corynebacterium sp. were resolved on an SDS-4 to 12%
polyacrylamide gel, transferred to PVDF membrane, and probed with a
1:2,000 dilution of the antibody to OmpA-like protein. Enhanced
chemiluminescence was used to detect the antigen-antibody complexes.
Lanes 1 to 3 contain the Coomassie blue-stained HS protein from
Acinetobacter, Pseudomonas, and a
Corynebacterium sp.; lanes 4 to 6 contain the corresponding
immunoblot for the Acinetobacter, Pseudomonas,
and Corynebacterium protein. The OmpA band is indicated.
|
|

View larger version (85K):
[in this window]
[in a new window]
|
FIG. 11.
Organisms isolated from mouse stomachs express the
OmpA-like protein. HS were prepared from subcultures of bacteria
isolated from two different mice infected with the gram-negative
organisms 6 months previously. The Coomassie blue-stained gel (lanes 2 to 6) is shown compared with the immunoblot (lanes 7 to 11) prepared
from the same samples and resolved in parallel. Antibody to the
OmpA-like protein was used at a 1:10,000 dilution. Lane 1 is a
Coomassie blue stain of the markers. Lanes 2 and 7 contain HS from the
mixed bacterial culture used to intubate the mice; lanes 3, 4, 8, and 9 contain HS prepared from the Acinetobacter subcultured from
the mice after 6 months; lanes 5 and 10 contain HS from a pure
subculture of the Acinetobacter spp.; lanes 6 and 11 contains HS from a pure subculture of the Pseudomonas spp.
The OmpA band is indicated. Numbers at left indicate molecular masses
in kilodaltons.
|
|
Acinetobacter species causes gastritis.
To prove
that Acinetobacter alone causes gastritis, endogenous
microbial flora was reduced with oral streptomycin prior to instilling
108 Acinetobacter organisms. Figure
12 shows the presence of a mucosal mononuclear infiltrate in the mouse corpus that extends into the submucosa (Fig. 12B) not present in the sham-intubated mouse (Fig. 12A). The infiltrate disrupted the normal architecture of the basally located chief and midglandular parietal cells. Thus, we concluded that
Acinetobacter spp. are capable of causing gastritis.

View larger version (126K):
[in this window]
[in a new window]
|
FIG. 12.
Acinetobacter spp. cause mouse gastritis.
Mice were treated orally for 5 days with streptomycin to sterilize the
mouse stomach prior to instilling Acinetobacter spp.
Stomachs from sham-intubated mice (A) were compared to stomachs from
mice intubated with 108 Acinetobacter organisms
for 2 months (B). Shown are representative sections from a
paraffin-embedded stomach stained with hemotoxylin and eosin. (A)
Normal (sham-intubated) mouse corpus (magnification, ×400); (B)
Acinetobacter-infected mouse corpus (magnification,
×400).
|
|
 |
DISCUSSION |
We hypothesize that one of the events occuring during bacterial
colonization of the stomach is the production of putative virulence
factors. We report here that the OmpA-like protein from an
Acinetobacter sp. stimulates the gastrin and IL-8 promoters and therefore would be capable of stimulating the production of this
hormone and this cytokine under conditions that would favor its
colonization in the stomach. This result has relevance to atrophic
gastritis, during which the pH of the stomach rises due to atrophy of
the parietal cell population, favoring colonization by aerobic and
anaerobic flora (22). Atrophic gastritis is a late feature
of chronic H. pylori infection but also occurs in pernicious
anemia and malnutrition and with advancing age. More importantly, the
loss of stomach acid is a risk factor for gastric cancer, presumably
due to an increase in N-nitroso compounds produced by colonizing
bacterial flora (2).
The antral G-cell response to bacterial infection of the gastric mucosa
has been most intensively studied for H. pylori infection. A
major consequence of H. pylori colonization is the increase in antral G cells and serum gastrin levels (21, 44). The
studies reported here clearly demonstrate that bacterial species other than H. pylori may colonize the stomach and cause
inflammation. Colonization by H. pylori does not occur
efficiently in the hypochlorhydric stomach due to competition by other
bacterial species (22). Thus, the ability of H. pylori to successfully compete with other bacteria for this rather
unique niche is primarily due to its ability to survive in the low-pH
environment of the stomach, e.g., at a pH of <3. Chronic H. pylori infection eventually results in atrophic gastritis,
resulting in achlorhydria or severe hypochlorhydria. The bacterial
overgrowth that follows is usually comprised of aerobic and anerobic
flora. Moreover, where malignant mucosal transformation has occurred,
H. pylori is absent (30, 41, 50). Thus, while
H. pylori infection may initiate the development of atrophic
gastritis, it may not mediate the final transforming event. Moreover,
it may not be the only bacterial species initiating these events.
The use of the gastrin reporter construct to identify specific
virulence factors was based on the proposal by Blaser and Parsonnet in
1994 that the hormone gastrin may play a role in ulcer and cancer
pathogenesis triggered by H. pylori infection
(5). Sustained levels of this hormone are associated with
duodenal ulcers (46) as well as neoplastic transformation
(8, 16, 43). Patients with chronic H. pylori
infection exhibit increases in serum gastrin and G-cell populations
concomitant with a decrease in D cells (21, 44). Yet, there
is no evidence that H. pylori has a direct effect on the G
cell. With respect to changes in G-cell numbers, several regulatory
mechanisms may be operating. First, bacterial proteins may have a
direct effect on the G cell. Second, there may be a loss of negative
regulation due to a direct effect on the D cell. Third, parietal cell
atrophy and subsequent achlorhydria may develop after longstanding
H. pylori infection, resulting in elevated serum gastrin
through the normal feedback regulatory mechanisms. Since atrophic
gastritis is accompanied by a decrease in H. pylori
colonization (15, 27), we examined whether organisms that
might colonize the hypochlorhydric stomach are capable of stimulating
gastrin. Gastrin activation by these organisms would provide a
mechanism by which growth factors may be produced in the preneoplastic stomach.
To address the role of bacterial proteins, we investigated whether
bacterial colonization activates gastrin promoter activity. We show in
this report that infection by bacterial flora that includes
Acinetobacter strains raises serum gastrin levels coincident with inflammation of the mucosa. Indeed, coculturing with the organisms
stimulated both the gastrin and IL-8 promoters in a dose-dependent
manner. The production and secretion of IL-8 or other CXC cytokines are
important mechanisms to recruit inflammatory mediators to the site of
infection (9). Therefore, we evaluated the ability of
Acinetobacter to stimulate IL-8 gene expression. The novel
finding reported here is that stimulation of both IL-8 and gastrin gene
expression by a bacterial protein is due to a member of the OmpA
protein family.
The OmpA-like protein has a low isoelectric point and no cysteines,
suggesting that it may be acid as well as heat stable. This may be
expected of proteins that are exposed to a low stomach pH. Residues 1 to 21 are hydrophobic and contain a signal peptide cleavage site
(AlaXAla) (38). The putative leader sequence is 38%
identical (76% similar) to the signal peptide for E. coli OmpA, which predicts protein translocation, export, and cleavage by
signal peptidase I (38). The putative cleavage site for the Acinetobacter spp. OmpA follows the
3,
1 rule for signal
peptides (13). Thus, the Acinetobacter spp. OmpA
leader sequence is consistent with the protein being present in the
outer membrane or periplasm.
The protein is closely related to the OmpA-related heat-modifiable
proteins from Moraxella and Pseudomonas as well
as the OmpA homologs from Salmonella, Shigella,
and Klebsiella spp. Antibody raised against the
Acinetobacter OmpA blocked IL-8 and gastrin promoter
activation. The novel Acinetobacter spp. protein was most
homologous to outer membrane protein CD precursor from
Moraxella (45% identical; 60% positive over 341 amino
acids). It also has ~25% identity and 40% similarity within the
C-terminal domain (268 to 333) to OmpA from E. coli and
Serratia, Salmonella, Shigella, and
Klebsiella bacterial species (23, 25, 26, 34, 36, 48). Apparently, OmpA proteins usually represent the major outer membrane protein, and all gram-negative bacteria have some functional equivalent of OmpA (3). The Acinetobacter spp.
OmpA protein was 30% identical (47% similar) over 321 amino acids to
outer membrane protein porin F (OprF) from Pseudomonas,
which is also a member of the OmpA protein family. Thus,
Acinetobacter spp. OmpA was also closely related to the
Pseudomonas porin proteins.
OmpA-related proteins including the Pseudomonas porin F
protein (OprF) appear to play a variety of roles depending on the bacterial species. In Pseudomonas, these proteins form pores
in mammalian cells that permit the penetration of solutes, support survival in low-osmosis conditions, maintain cell shape, and
participate in antimicrobial resistance (40). OmpA from
E. coli and Shigella, Salmonella,
Serratia, and Klebsiella spp. is the prevalent
outer membrane protein and is highly immunogenic. It is also a receptor for bacterial phages, mediates F'-pilus-dependent conjugation, and
maintains cell shape (4, 20, 35, 37, 39).
Acinetobacter spp. OmpA is quite heat stable, and this
property may be related to the heat-modifiable characteristic of most
OmpA proteins including the M. catarrhalis CD (23,
33). This property is also a characteristic of E. coli
OmpA, OmpA from enteropathogens, and H. pylori porin proteins (12, 14, 25, 26, 36, 48). Heat-modifiable proteins
migrate in a heterogeneous pattern on SDS gels after heating due to a
conformational change in the protein (3).
In summary, this is the first report documenting regulation of the
human gastrin promoter by a bacterial protein, raising the strong
possibility that bacterial proteins alone, exclusive of inflammation,
may be sufficient to mediate elevated serum gastrin levels. This is
also the first report of an effect of an OmpA-like protein on mammalian
gene expression. IL-8 promoter activity was also activated, consistent
with prior reports showing general activation of IL-8 production when
epithelial cells are cocultured with a variety of bacterial strains.
The results also suggest that opportunistic pathogens may regulate both
gastrin and IL-8 production in part by producing OmpA-like proteins.
The results do not rule out the possibility that other bacterial
proteins affect cell function, but it is clear that the 38-kDa OmpA is the major protein within the heat-stable fraction of
Acinetobacter spp. that is capable of activating these two promoters.
 |
ACKNOWLEDGMENTS |
J.L.M. is an investigator of the Howard Hughes Medical Institute.
The work was supported in part by Public Health Service grant DK-45729.
We thank Charles Mitchell of the University of Michigan Protein and
Carbohydrate Structure Facility Core and H. C. Reinecker of the
Massachusetts General Hospital for the gift of the IL-8 luciferase
promoter construct. Also, Susan Finnis of the University of Michigan
Peptide Center (DK-34933) performed the gastrin radioimmunoassays, and
the University of Michigan Clinical Microbiology Laboratory performed
the bacterial subtyping.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: 1150 West
Medical Dr., MSRB I, 3510, Ann Arbor, MI 48109-0650. Phone: (734)
647-2944. Fax: (734) 936-1400. E-mail: merchanj{at}umich.edu.
Editor:
J. D. Clements
 |
REFERENCES |
| 1.
|
Barranco, S. C.,
C. M. Townsend, Jr.,
C. Casartelli,
B. G. Macik,
N. L. Burger,
W. R. Boerwinkle, and W. K. Gourley.
1983.
Establishment and characterization of an in vitro model system for human adenocarcinoma of the stomach.
Cancer Res.
43:1703-1709[Abstract/Free Full Text].
|
| 2.
|
Bartsch, H.,
H. Ohshima,
B. Pignatelli, and S. Calmels.
1992.
Endogenously formed N-nitroso compounds and nitrosating agents in human cancer etiology.
Pharmacogenetics
2:272-277[CrossRef][Medline].
|
| 3.
|
Beher, M. G.,
C. A. Schnaitman, and A. P. Pugsley.
1980.
Major heat-modifiable outer membrane protein in gram-negative bacteria: comparison with the OmpA protein of Escherichia coli.
J. Bacteriol.
143:906-913[Abstract/Free Full Text].
|
| 4.
|
Behrmann, M.,
H. G. Koch,
T. Hengelage,
B. Wieseler,
H. K. Hoffschulte, and M. Muller.
1998.
Requirements for the translocation of elongation-arrested, ribosome-associated OmpA across the plasma membrane of Escherichia coli.
J. Biol. Chem.
273:13898-13904[Abstract/Free Full Text].
|
| 5.
|
Blaser, M. J., and J. Parsonnet.
1994.
Parasitism by the "slow" bacterium Helicobacter pylori leads to altered gastric homeostasis and neoplasia.
J. Clin. Investig.
94:4-8.
|
| 6.
|
Bradford, M. M.
1976.
A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding.
Anal. Biochem.
72:248-254[CrossRef][Medline].
|
| 7.
|
Brand, S. J., and D. Stone.
1988.
Reciprocal regulation of antral gastrin and somatostatin gene expression by omeprazole-induced achlorhydria.
J. Clin. Investig.
82:1059-1066.
|
| 8.
|
Conteas, C. N.,
T. K. Desai, and F. A. Arlow.
1988.
Relationship of hormones and growth factors to colon cancer.
Gastroenterol. Clin. N. Am.
17:761-772.
|
| 9.
|
Crabtree, J.
1998.
Role of cytokines in pathogenesis of Helicobacter pylori-induced mucosal damage.
Dig. Dis. Sci.
43(Suppl.):46S-53S[CrossRef][Medline].
|
| 10.
|
Craven, D. E.,
T. W. Barber,
K. A. Steger, and M. A. Montecalvo.
1990.
Nosocomial pneumonia in the 1990s: update of epidemiology and risk factors.
Semin. Respir. Infect.
5:157-172[Medline].
|
| 11.
|
Dockray, G. J.
1999.
Topical review. Gastrin and gastric epithelial physiology.
J. Physiol. (London)
518:315-324[Abstract/Free Full Text].
|
| 12.
|
Doig, P., and T. J. Trust.
1994.
Identification of surface-exposed outer membrane antigens of Helicobacter pylori.
Infect. Immun.
62:4526-4533[Abstract/Free Full Text].
|
| 13.
|
Duffaud, G., and M. Inouye.
1988.
Signal peptidases recognize a structural feature at the cleavage site of secretory proteins.
J. Biol. Chem.
263:10224-10228[Abstract/Free Full Text].
|
| 14.
|
Exner, M. M.,
P. Doig,
T. J. Trust, and R. E. Hancock.
1995.
Isolation and characterization of a family of porin proteins from Helicobacter pylori.
Infect. Immun.
63:1567-1572[Abstract].
|
| 15.
|
Farinati, F.,
F. Valiante,
B. Germana,
G. Della Libera,
R. Baffa,
M. Rugge,
M. Plebani,
F. Vianello,
F. Di Mario, and R. Naccarato.
1993.
Prevalence of Helicobacter pylori infection in patients with precancerous changes and gastric cancer.
Eur. J. Cancer Prev.
2:321-326[Medline].
|
| 16.
|
Finley, G. G.,
R. A. Koski,
M. F. Melhem,
J. M. Pipas, and A. I. Meisler.
1993.
Expression of the gastrin gene in the normal human colon and colorectal adenocarcinoma.
Cancer Res.
53:2919-2926[Abstract/Free Full Text].
|
| 17.
|
Ford, M. G.,
J. D. Valle,
C. J. Soroka, and J. L. Merchant.
1997.
EGF receptor activation stimulates endogenous gastrin gene expression in canine G cells and human gastric cell cultures.
J. Clin. Investig.
99:2762-2771[Medline].
|
| 18.
|
Freifelder, D.
1983.
Translation I: the information problem, p. 367-413.
In
D. Freifelder (ed.), Molecular biology, 2nd ed. Jones and Bartlett, Portola Valley, Calif.
|
| 19.
|
Garrouste-Orgeas, M.,
S. Chevret,
G. Arlet,
O. Marie,
M. Rouveau,
N. Popoff, and B. Schlemmer.
1997.
Oropharyngeal or gastric colonization and nosocomial pneumonia in adult intensive care unit patients. A prospective study based on genomic DNA analysis.
Am. J. Respir. Crit. Care Med.
156:1647-1655[Abstract/Free Full Text].
|
| 20.
|
Ghiara, P.,
M. Rossi,
M. Marchetti,
A. Di Tommaso,
C. Vindigni,
F. Ciampolini,
A. Covacci,
J. L. Telford,
M. T. De Magistris,
M. Pizza,
R. Rappuoli, and G. Del Giudice.
1997.
Therapeutic intragastric vaccination against Helicobacter pylori in mice eradicates an otherwise chronic infection and confers protection against reinfection.
Infect. Immun.
65:4996-5002[Abstract].
|
| 21.
|
Graham, D. Y.,
G. M. Lew, and J. Lechago.
1993.
Antral G-cell and D-cell numbers in Helicobacter pylori infection: effect of H. pylori eradication.
Gastroenterology
104:1655-1660[Medline].
|
| 22.
|
Houben, G. M., and R. W. Stockbrugger.
1995.
Bacteria in the aetio-pathogenesis of gastric cancer: a review.
Scand. J. Gastroenterol. Suppl.
212:13-18[Medline].
|
| 23.
|
Hsiao, C. B.,
S. Sethi, and T. F. Murphy.
1995.
Outer membrane protein CD of Branhamella catarrhalis: sequence conservation in strains recovered from the human respiratory tract.
Microb. Pathog.
19:215-225[CrossRef][Medline].
|
| 24.
|
Keates, S.,
Y. S. Hitti,
M. Upton, and C. P. Kelly.
1997.
Helicobacter pylori infection activates NF- B in gastric epithelial cells.
Gastroenterology
113:1099-1109[CrossRef][Medline].
|
| 25.
|
Kennell, W. L.,
C. Egli,
R. E. Hancock, and S. C. Holt.
1992.
Pore-forming ability of major outer membrane proteins from Wolinella recta ATCC 33238.
Infect. Immun.
60:380-384[Abstract/Free Full Text].
|
| 26.
|
Komatsuzawa, H.,
T. Kawai,
M. E. Wilson,
M. A. Taubman,
M. Sugai, and H. Suginaka.
1999.
Cloning of the gene encoding the Actinobacillus actinomycetemcomitans serotype b OmpA-like outer membrane protein.
Infect. Immun.
67:942-945[Abstract/Free Full Text].
|
| 27.
|
Kuipers, E. J.
1999.
Review article: exploring the link between Helicobacter pylori and gastric cancer.
Aliment. Pharmacol. Ther.
13(Suppl. 1):3-11.
|
| 28.
|
Lane, D. J.,
B. Pace,
G. J. Olsen,
D. A. Stahl,
M. L. Sogin, and N. R. Pace.
1985.
Rapid determination of 16S ribosomal RNA sequences for phylogenetic analyses.
Proc. Natl. Acad. Sci. USA
82:6955-6959[Abstract/Free Full Text].
|
| 29.
|
Lawrence, J. G.,
H. Ochman, and D. L. Hartl.
1991.
Molecular and evolutionary relationships among enteric bacteria.
J. Gen. Microbiol.
137:1911-1921[Abstract/Free Full Text].
|
| 30.
|
McCloy, R. F.,
R. Arnold,
K. D. Bardhan,
D. Cattan,
E. Klinkenberg-Knol,
P. N. Maton,
R. H. Riddell,
P. Sipponen, and A. Walan.
1995.
Pathophysiological effects of long-term acid suppression in man.
Dig. Dis. Sci.
40:96S-120S[CrossRef][Medline].
|
| 31.
|
Moss, S. F.,
S. Legon,
A. E. Bishop,
J. M. Polak, and J. Calam.
1992.
Effect of Helicobacter pylori on gastric somatostatin in duodenal ulcer disease.
Lancet
340:930-932[CrossRef][Medline].
|
| 32.
|
Mukaida, N.,
M. Shiroo, and K. Matsushima.
1989.
Genomic structure of the human monocyte-derived neutrophil chemotactic factor IL-8.
J. Immunol.
143:1366-1371[Abstract].
|
| 33.
|
Murphy, T. F.,
C. Kirkham,
E. DeNardin, and S. Sethi.
1999.
Analysis of antigenic structure and human immune response to outer membrane protein CD of Moraxella catarrhalis.
Infect. Immun.
67:4578-4585[Abstract/Free Full Text].
|
| 34.
|
Murphy, T. F.,
C. Kirkham, and A. J. Lesse.
1993.
The major heat-modifiable outer membrane protein CD is highly conserved among strains of Branhamella catarrhalis.
Mol. Microbiol.
10:87-97[CrossRef][Medline].
|
| 35.
|
Nguyen, T. N.,
P. Samuelson,
F. Sterky,
C. Merle-Poitte,
A. Robert,
T. Baussant,
J. F. Haeuw,
M. Uhlen,
H. Binz, and S. Stahl.
1998.
Chromosomal sequencing using a PCR-based biotin-capture method allowed isolation of the complete gene for the outer membrane protein A of Klebsiella pneumoniae.
Gene
210:93-101[CrossRef][Medline].
|
| 36.
|
Ohnishi, S.,
K. Kameyama, and T. Takagi.
1998.
Characterization of a heat modifiable protein, Escherichia coli outer membrane protein OmpA, in binary surfactant system of sodium dodecyl sulfate and octylglucoside.
Biochim. Biophys. Acta
1375:101-109[Medline].
|
| 37.
|
Ortiz, V.,
A. Isibasi,
E. Garcia-Ortigoza, and J. Kumate.
1989.
Immunoblot detection of class-specific humoral immune response to outer membrane proteins isolated from Salmonella typhi in humans with typhoid fever.
J. Clin. Microbiol.
27:1640-1645[Abstract/Free Full Text].
|
| 38.
|
Pratap, J., and K. L. Dikshit.
1998.
Effect of signal peptide changes on the extracellular processing of streptokinase from Escherichia coli: requirement for secondary structure at the cleavage junction.
Mol. Gen. Genet.
258:326-333[CrossRef][Medline].
|
| 39.
|
Puohiniemi, R.,
M. Karvonen,
J. Vuopio-Varkila,
A. Muotiala,
I. M. Helander, and M. Sarvas.
1990.
A strong antibody response to the periplasmic C-terminal domain of the OmpA protein of Escherichia coli is produced by immunization with purified OmpA or with whole E. coli or Salmonella typhimurium bacteria.
Infect. Immun.
58:1691-1696[Abstract/Free Full Text].
|
| 40.
|
Rawling, E. G.,
F. S. Brinkman, and R. E. Hancock.
1998.
Roles of the carboxy-terminal half of Pseudomonas aeruginosa major outer membrane protein OprF in cell shape, growth in low-osmolarity medium, and peptidoglycan association.
J. Bacteriol.
180:3556-3562[Abstract/Free Full Text].
|
| 41.
|
Safatle-Ribeiro, A. V.,
U. Ribeiro, Jr.,
M. R. Clarke,
P. Sakai,
S. Ishioka,
A. B. Garrido, Jr.,
J. Gama-Rodrigues,
N. F. Safatle, and J. C. Reynolds.
1999.
Relationship between persistence of Helicobacter pylori and dysplasia, intestinal metaplasia, atrophy, inflammation, and cell proliferation following partial gastrectomy.
Dig. Dis. Sci.
44:243-252[CrossRef][Medline].
|
| 42.
|
Seery, J. P.
1991.
Achlorhydria and gastric carcinogenesis.
Lancet
338:1508-1509[CrossRef][Medline].
|
| 43.
|
Singh, P.,
A. Owlia,
A. Varro,
B. Dai,
S. Rajaraman, and T. Wood.
1996.
Gastrin gene expression is required for the proliferation and tumorigenicity of human colon cancer cells.
Cancer Res.
56:4111-4115[Abstract/Free Full Text].
|
| 44.
|
Sumii, M.,
K. Sumii,
A. Tari,
H. Kawaguchi,
G. Yamamoto,
Y. Takehara,
Y. Fukino,
T. Kamiyasu,
M. Hamada,
T. Tsuda,
M. Yoshihara,
K. Haruma, and G. Kajiyama.
1994.
Expression of antral gastrin and somatostatin mRNA in Helicobacter pylori-infected subjects.
Am. J. Gastroenterol.
89:1515-1519[Medline].
|
| 45.
|
Torres, A.,
M. El-Ebiary,
N. Soler,
C. Monton,
N. Fabregas, and C. Hernandez.
1996.
Stomach as a source of colonization of the respiratory tract during mechanical ventilation: association with ventilator-associated pneumonia.
Eur. Respir. J.
9:1729-1735[Abstract].
|
| 46.
|
Walsh, J. H., and M. I. Grossman.
1975.
Gastrin.
N. Engl. J. Med.
292(Part 2):1377-1384[Medline].
|
| 47.
|
Wang, T. C.,
C. A. Dangler,
D. Chen,
J. R. Goldenring,
T. Koh,
R. Raychowdhury,
R. J. Coffey,
S. Ito,
A. Varro,
G. J. Dockray, and J. G. Fox.
2000.
Synergistic interaction between hypergastrinemia and Helicobacter infection in a mouse model of gastric cancer.
Gastroenterology
118:36-47[CrossRef][Medline].
|
| 48.
|
Wexler, H. M.,
C. Getty, and G. Fisher.
1992.
The isolation and characterisation of a major outer-membrane protein from Bacteroides distasonis.
J. Med. Microbiol.
37:165-175[Abstract/Free Full Text].
|
| 49.
|
Yang, Y. P.,
L. E. Myers,
U. McGuinness,
P. Chong,
Y. Kwok,
M. H. Klein, and R. E. Harkness.
1997.
The major outer membrane protein, CD, extracted from Moraxella (Branhamella) catarrhalis is a potential vaccine antigen that induces bactericidal antibodies.
FEMS Immunol. Med. Microbiol.
17:187-199[CrossRef][Medline].
|
| 50.
|
Zhang, Z. F.,
R. C. Kurtz,
D. S. Klimstra,
G. P. Yu,
M. Sun,
S. Harlap, and J. R. Marshall.
1999.
Helicobacter pylori infection on the risk of stomach cancer and chronic atrophic gastritis.
Cancer Detect. Prev.
23:357-367[CrossRef][Medline].
|
Infection and Immunity, June 2000, p. 3657-3666, Vol. 68, No. 6
0019-9567/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Fukui, T, Nishio, A, Okazaki, K, Uza, N, Ueno, S, Kido, M, Inoue, S, Kitamura, H, Kiriya, K, Ohashi, S, Asada, M, Tamaki, H, Matsuura, M, Kawasaki, K, Suzuki, K, Uchida, K, Fukui, H, Nakase, H, Watanabe, N, Chiba, T
(2006). Gastric mucosal hyperplasia via upregulation of gastrin induced by persistent activation of gastric innate immunity in major histocompatibility complex class II deficient mice. Gut
55: 607-615
[Abstract]
[Full Text]
-
Siroy, A., Molle, V., Lemaitre-Guillier, C., Vallenet, D., Pestel-Caron, M., Cozzone, A. J., Jouenne, T., De, E.
(2005). Channel Formation by CarO, the Carbapenem Resistance-Associated Outer Membrane Protein of Acinetobacter baumannii. Antimicrob. Agents Chemother.
49: 4876-4883
[Abstract]
[Full Text]
-
Barbe, V., Vallenet, D., Fonknechten, N., Kreimeyer, A., Oztas, S., Labarre, L., Cruveiller, S., Robert, C., Duprat, S., Wincker, P., Ornston, L. N., Weissenbach, J., Marliere, P., Cohen, G. N., Medigue, C.
(2004). Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium. Nucleic Acids Res
32: 5766-5779
[Abstract]
[Full Text]
-
Leung, S. Y., Chen, X., Chu, K. M., Yuen, S. T., Mathy, J., Ji, J., Chan, A. S. Y., Li, R., Law, S., Troyanskaya, O. G., Tu, I-P., Wong, J., So, S., Botstein, D., Brown, P. O.
(2002). Phospholipase A2 group IIA expression in gastric adenocarcinoma is associated with prolonged survival and less frequent metastasis. Proc. Natl. Acad. Sci. USA
99: 16203-16208
[Abstract]
[Full Text]
-
Zavros, Y., Rieder, G., Ferguson, A., Merchant, J. L.
(2002). Gastritis and Hypergastrinemia Due to Acinetobacter lwoffii in Mice. Infect. Immun.
70: 2630-2639
[Abstract]
[Full Text]
-
Verduin, C. M., Hol, C., Fleer, A., van Dijk, H., van Belkum, A.
(2002). Moraxella catarrhalis: from Emerging to Established Pathogen. Clin. Microbiol. Rev.
15: 125-144
[Abstract]
[Full Text]
-
Toren, A., Orr, E., Paitan, Y., Ron, E. Z., Rosenberg, E.
(2002). The Active Component of the Bioemulsifier Alasan from Acinetobacter radioresistens KA53 Is an OmpA-Like Protein. J. Bacteriol.
184: 165-170
[Abstract]
[Full Text]
-
Aeckersberg, F., Lupp, C., Feliciano, B., Ruby, E. G.
(2001). Vibrio fischeri Outer Membrane Protein OmpU Plays a Role in Normal Symbiotic Colonization. J. Bacteriol.
183: 6590-6597
[Abstract]
[Full Text]
-
Toren, A., Navon-Venezia, S., Ron, E. Z., Rosenberg, E.
(2001). Emulsifying Activities of Purified Alasan Proteins from Acinetobacter radioresistens KA53. Appl. Environ. Microbiol.
67: 1102-1106
[Abstract]
[Full Text]