Previous Article | Next Article ![]()
Infection and Immunity, June 2001, p. 3845-3852, Vol. 69, No. 6
Laboratoire de Parasitologie
Biomédicale, Institut Pasteur, 75015 Paris Cedex 15, France
Received 6 December 2000/Returned for modification 29 January
2001/Accepted 26 March 2001
The Plasmodium falciparum liver-stage antigen 3 (LSA3),
a recently identified preerythrocytic antigen, induces protection against malaria in chimpanzees. Using antibodies from individuals with
hyperimmunity to malaria affinity purified on recombinant or synthetic
polypeptides of LSA3, we identified four non-cross-reactive B-cell
epitopes in Plasmodium yoelii preerythrocytic stages. On sporozoites the P. yoelii protein detected has a molecular
mass similar to that of LSA3. T-cell epitopes cross-reacting with
P. yoelii were also demonstrated using peripheral blood
lymphocytes from LSA3-immunized chimpanzees. In contrast, no
cross-reactive epitopes were found in Plasmodium
berghei. LSA3-specific human antibodies exerted up to 100%
inhibition of in vitro invasion of P. yoelii sporozoites
into mouse hepatocytes. This strong in vitro activity was reproduced in
vivo by passive transfer of LSA3 antibodies. These results indicate
that the homologous epitopes may be biologically functional and suggest
that P. yoelii could be used as a model to assess the
antisporozoite activity of anti-LSA3 antibodies.
The development of a malaria
preerythrocytic vaccine has been greatly influenced by the observation
that sterile immunity could be experimentally induced in humans
by immunization with Plasmodium falciparum
radiation-attenuated sporozoites (9). The critical role of
liver-stage trophozoites (reviewed in reference 16)
led researchers to initiate a detailed study of the antigens expressed
in P. falciparum preerythrocytic stages (22).
To date, scientists have identified a series of new molecules expressed at sporozoite and/or liver stage (14). Liver-stage antigen
3 (LSA3), expressed on both the sporozoite surface and in the liver forms, was found to be of particular interest. LSA3 was identified by
differential screening of immune responses from protected versus nonprotected volunteers (11). A number of dominant B- and
T-cell epitopes to which a high prevalence of responses is detected in individuals exposed to malaria or in LSA3-immunized animals were identified (1, 2). The vaccine potential of this molecule has been recently demonstrated in the chimpanzee model, an animal susceptible and fully receptive to P. falciparum
preerythrocytic stages and whose immune system is closest to that of
humans. In this model, protection against successive challenges with
P. falciparum sporozoites was obtained
(11). However, the use of this primate for research
purposes is severely hampered by cost and ethical constraints.
Several homologues of P. falciparum antigens have been
identified, through a variety of immunological and molecular
cross-reactivity assays, in other Plasmodium species and
particularly in those infecting rodents (5, 10, 12, 13, 27,
28). The identification of structurally and
functionally conserved homologues of P. falciparum proteins
in rodent malaria species might help to better understand the
role of these molecules in the P. falciparum parasite
life cycle. This is particularly true for preerythrocytic stages, where the relative ease of obtaining sporozoites and mouse primary
hepatocytes would allow more extensive investigations to be carried out.
In the process of identification of LSA3, a preerythrocytic subset of
P. falciparum genomic fragments (22) was
used to affinity purify antibodies (Abs) from sera of
individuals with hyperimmunity to malaria. These Abs were
consequently checked for immunofluorescence antibody test (IFAT)
cross-reactivity with rodent malaria sporozoites, and in this assay Abs
against all clones coding for various fragments of LSA3 proved to be
strongly reactive with Plasmodium yoelii sporozoites but not
with those from Plasmodium berghei.
The present study was undertaken to investigate the extent of antigenic
cross-reactivity between the LSA3 molecule and its putative homologue
in P. yoelii and to determine whether specific human Abs are
of biological significance in the mouse model. We show that such
cross-reactivity exists for human anti-LSA3 Abs, which encompass four
distinct LSA3 epitopes, including both nonrepeated and repeated
domains, and extend to both sporozoite and liver stages of P. yoelii. A similar result was obtained using Abs from chimpanzees
immunized with LSA3. Moreover, P. yoelii, but not P. berghei, sporozoites were able to induce dose-dependent
proliferation of T cells collected from one of these animals. Finally,
we have established that these homologous epitopes are targets for
immune responses which have a biological consequence, since
LSA3-specific human Abs inhibit the invasion of P. yoelii sporozoites into mouse hepatocytes both in vitro and in vivo.
Recombinant proteins and peptides.
Three recombinant
proteins corresponding to the 5' end (
0019-9567/01/$04.00+0 DOI: 10.1128/IAI.69.6.3845-3952.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
Human Antibodies against Plasmodium falciparum
Liver-Stage Antigen 3 Cross-React with Plasmodium
yoelii Preerythrocytic-Stage Epitopes and Inhibit Sporozoite
Invasion In Vitro and In Vivo
![]()
ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References
-Gal-DG729, GST-729 [
-Gal,
-galactosidase; GST, glutathione S-transferase]), central region (GST-NN), and 3' end (GST-PC) of the LSA3 gene product
(Fig. 1) were produced as previously
described (11).
-Gal-DG671 and GST-671 derived from the
P. falciparum sporozoite and liver-stage antigen (SALSA)
molecule were prepared as previously described (3) and
used as controls (1, 3). The peptides LSA3-RE
(VESVAPSVEESVAPSVEESVAENVEESV). LSA3-NRI
(DELFNELLNSVDVNGENILEESQ), and LSA3-NRII
(LEESQVNDDIFNSLVKSVQQEQQHNV) correspond to the
sequences of the gene in P. falciparum T9-96 clone
(11), and the SALSA2 peptide
(NGKDDVKEEKKTNEKKDDGKTDQEKVLEKSPKEF)
was also derived from the gene of T9-96 (3). All the
peptides used in this study were prepared by solid-phase synthesis
(25).
![]()
View larger version (9K):
[in a new window]
FIG. 1.
Location of the various LSA3 peptides and recombinant
proteins. R1, R2, and R3 represent repeat regions. DG729, NN, and PC
sequences were expressed as either GST-fused or
-Gal-fused
recombinant proteins (see Materials and Methods).
Abs. (i) Human Abs.
Sera were collected from African adults
living in the Ivory Coast (hyperimmune sera), an area where malaria is
hyperendemic. These adults were more than 20 years old and no longer
show signs of clinical malaria, even though they are exposed to malaria
infections, suggesting that they have acquired antiparasite immunity
and are clinically protected (22). Human Abs were affinity
purified on the recombinant proteins
-Gal-DG729 and
-Gal-DG671 by
successive absorption of Abs from seven hyperimmune patients' sera
that had been depleted of Abs reactive with
-galactosidase
(22). Briefly, the recombinant proteins induced by and
adsorbed on isopropylthiogalactoside-impregnated nitrocellulose filters
(BA 85; Schleicher & Schuell, Dassel, Germany) were incubated
successively with each hyperimmune individual's serum and washed
extensively. Abs were eluted using 0.2 M glycine (pH 2.5) and were
immediately neutralized by addition of 2 M Tris, pH 11. Eluted Abs were
dialyzed first against phosphate-buffered saline (PBS), pH 7.4, and
then against RPMI medium in both cases over 24 h at 4°C. Samples
were concentrated using a Centricon 30 membrane (Amicon; Millipore,
Bedford, Mass.) to a volume corresponding to a 1/20 dilution of the
original serum.
(ii) Chimpanzee sera.
Anti-LSA3 sera were obtained from
animals immunized with
-Gal-DG729 (chimpanzee Dirk) or with the
lipopeptide NRII (chimpanzee Gerda) (1). Anti-SALSA serum
was obtained from chimpanzee Bart immunized with
-Gal-DG671
(3). The sera used in this study were collected 15 days
after the third immunization and stored frozen at
80°C until use.
(iii) Anti-P. yoelii sera. BALB/c and C3H/Hej mice were infected intravenously (i.v.) with 150 live sporozoites or intraperitoneally with 104 parasitized red blood cells of P. yoelii 17XNL. Peripheral blood parasitemia was detectable from day 5 in the mice infected with sporozoites and at day 3 in the mice infected with parasitized red blood cells. Sera were collected from mice bled 6 days after sporozoite infection and 14 days after blood infection.
Parasites.
P. falciparum (NF54), P. yoelii (either 17XNL, clone 1.1 derived from 17XNL, or 265BY), and
P. berghei (ANKA strain) sporozoites were prepared
aseptically, resuspended in RPMI medium, and were either stored at
70°C for future T-cell assays or were fixed with 0.01%
glutaraldehyde (15) and stored at 4°C before use for
IFAT. P. yoelii liver-stage schizonts were obtained by i.v. injection of 106 sporozoites into the tail vein of C3H/HeJ
mice. Infected livers were removed 44 h later and embedded in
Tissue-Tek O.C.T. compound (Tissue-Tek; SAKURA, Zoeterwoude, The
Netherlands), and frozen sections were prepared for use in IFAT. Blood
stages of the two rodent malaria species were obtained by infecting
BALB/c mice with 104 infected red blood cells. Thin blood
smears were made when parasitemia reached 20 to 25%.
IFAT.
The reactivity of human and animal Abs with either
sporozoites, infected hepatocytes, or infected erythrocytes was
assessed by incubating antibodies for 30 min at 37°C with (i)
glutaraldehyde-fixed sporozoites, (ii) cryosections of infected liver
tissue fixed 10 min in cold acetone (
20°C), and (iii) air-dried,
acetone-fixed, blood-stage parasites. The slides were then washed three
times with PBS, and the contents were incubated for a further 30 min with fluorescein isothiocyanate-labeled goat anti-human immunoglobulin G (IgG), IgA, and IgM (Diagnostic Pasteur, Rarnes-la-Coquette, France)
or anti-mouse IgG, IgA, and IgM (Cappel; Organon Teknika, West Chester,
Pa.). In all cases, they were diluted 1/200 in PBS supplemented with
1/2,000 Evans blue.
Western blot analysis. Proteins from 106 P. yoelii sporozoites were solubilized in sodium dodecyl sulfate-containing sample buffer, subjected to electrophoresis under reducing conditions on sodium dodecyl sulfide-5% polyacrylamide gels, electroblotted onto nitrocellulose membranes, and incubated with Abs as described previously (17).
ELISA. The ELISA was performed essentially as described in reference 4. Prior to conducting the ELISA, for each recombinant protein and each synthetic peptide, preliminary experiments were made to determine the optimal conditions for coating and for subsequent incubations with the same sera from hyperimmune individuals used in this study (SHI1 to SHI8) and 10 serum samples from healthy French blood donors with no history of malaria exposure. Hence, optimal antigen concentrations employed differ from one molecule to the other and particularly between recombinants and synthetic peptides. The Ab ratio was calculated by dividing the mean optical density at 492 nm (OD492) of the test serum by the mean plus 3 standard deviations of the 10 control serum samples from the same plates. Briefly, 96-well ELISA plates (Nunc, Roskilde, Denmark) were coated overnight at 4°C with 50 µl of recombinant proteins at 0.5 µg/ml (GST-729 and GST-NN) or 10 µg/ml (GST-PC and GST-DG671) or with 50 µl of synthetic peptide solution at 10 µg/ml (LSA3-RE), 3 µg/ml (LSA3-NRI and LSA3-NRII) in PBS (pH 7.4), or 5 µg/ml (SALSA2) in Tris, pH 7.4. ELISA was performed in duplicate as previously described (4). Human affinity-purified Abs were tested undiluted, and sera from mice infected with P. yoelii were tested at 1/100 dilution. Peroxidase anti-human IgG (heavy plus light chains) and anti-mouse IgG (heavy plus light chains) (Biosys, Compiègne, France) were used as the second Ab. The results are expressed as the mean OD for human affinity-purified Abs and for mouse sera as a ratio of the mean OD of the sera from immunized mice to the mean OD of sera from preimmune mice.
T-cell assays.
Heparinized venous blood, collected from
chimpanzee Gerda (immunized by LSA3 lipopeptide NRII), was used to
isolate peripheral blood mononuclear cells (PBMC) by centrifugation on
Ficoll-Hypaque density gradient, which were then used for the T-cell
proliferation assay (1). Cells (2 × 105/well) were cultured in a 96 flat-bottomed-well plate
(Costar, Cambridge, Mass.) in the presence of freeze-thawed P. yoelii or P. berghei sporozoites (at concentrations
equivalent to 50, 150, 500, 1,500, or 5,000 sporozoites per well) for 5 days in RPMI 1640 medium supplemented with 10% human AB serum. One
microcurie of [3H]thymidine ([3H]TdR)
(Amersham, Les Ulis, France) was added to each well for the final
16 h of culture. The results were expressed as stimulation indices, which were calculated by dividing the mean counts per minute
of [3H]TdR incorporated into stimulated culture cells by
the mean counts per minute of [3H]TdR incorporated into
unstimulated cell cultures (
cpm; average of triplicates).
Inhibition-of-liver-stage-development assay. Human Abs affinity purified upon the recombinant protein DG729 (LSA3) were tested for their inhibitory effect on P. yoelii invasion into hepatocytes as previously described (24). Human anti-DG671 (SALSA) antibodies were used as controls. Briefly, mouse hepatocytes suspended in complete medium were seeded in eight-chamber Lab-Tek plastic slides (Nunc Inc., Naperville, Ill.) at a ratio of 105 cells/chamber. After a 24-h incubation at 37°C in a 5% CO2 atmosphere, the medium was removed and both anti-DG729 Abs (or anti-SALSA Abs) and 6 × 104 P. yoelii or P. berghei sporozoites (clone 1.1 or ANKA strain, respectively) suspended in culture medium were simultaneously added to hepatocyte cultures. After 3 h at 37°C, the medium containing Abs and noninvaded sporozoites was discarded and replaced by fresh medium. After 48 h of culture, hepatocytes were fixed for 10 min in cold methanol and developing P. yoelii liver stages were identified by IFAT with the monoclonal Ab (MAb) NYLS3 as described in reference 8 by epifluorescence, using an Olympus UV microscope. The human Abs were tested at a concentration corresponding to their IFAT end point titer (1/2), at which the reactivity on the surface of the sporozoites was still detectable.
Parallel experiments were performed with P. berghei to evaluate interspecies inhibition. The MAb directed against the circumsporozoite protein (CS) of P. berghei was used as control of inhibition of P. berghei sporozoite invasion and to detect P. berghei liver schizonts by IFAT staining, as described in reference 8. The anti-CS MAb of P. berghei was used at a dilution of 5 × 10
4 (IFAT end point titer of
10
6).
The total number of liver schizonts in each culture well was counted
and used to calculate the mean number of the liver schizonts in
duplicate culture wells. Results were expressed as the percentage of
inhibition: (number of liver schizonts in control
number of
liver schizonts in test/number of liver schizonts in control) × 100.
In vivo passive protection by Abs. To assess the in vivo effects of human affinity-purified Abs on the development of P. yoelii, 100 µg of either anti-DG729-specific Ab, control human anti-DG671 Abs, or RPMI medium per ml was added to 150 sporozoites of P. yoelii. The two components were mixed in a 1-ml syringe immediately before i.v. inoculation into the tail vein of BALB/c mice. Parasitemia was monitored from day 4 to day 21 by microscopic examination of Giemsa-stained thin smears of tail blood. The binding of the Abs to the sporozoites was tested by a direct fluorescence assay using the mixture remaining in the syringe after inoculation. A drop of this mixture was spread on a glass slide, air dried, and fixed for 10 min in acetone. Fluorescein isothiocyanate-labeled goat anti-human IgG, IgA, or IgM (Diagnostic Pasteur) was then added at 1/200 dilution for 30 min at 37°C. The slides were then washed, mounted in 30% glycerol in PBS, and examined under UV light.
| |
RESULTS |
|---|
|
|
|---|
Human anti-P. falciparum LSA3 Abs react with
P. yoelii preerythrocytic stages.
Abs from
hyperimmune individuals were affinity purified on three
recombinant fusion proteins previously reported as
-Gal-DG729, GST-NN, and GST-PC (11), which correspond to the
N-terminal region, the R2 repeats, and the C-terminal region of LSA3,
respectively (Fig. 1). Anti-DG729 and -NN (containing Glu-rich repeat
regions) and anti-PC Abs proved to define distinct groups of
non-cross-reactive epitopes (Table
1). The three isolated Ab fractions were
tested by IFAT upon sporozoites from P. falciparum and
from the two rodent malaria species P. yoelii and
P. berghei. Strong surface labeling of the
P. falciparum and P. yoelii
sporozoites, but not of those of P. berghei, was
observed for all three Ab fractions (Table 2). Epitopes contained within the DG729
recombinant protein were further analyzed using human Abs
immunopurified on synthetic peptides corresponding to the repeat
(LSA3-RE) or the nonrepeat (LSA3-NRII) regions (Fig. 1). These two
peptides define non-cross-reactive epitopes (Table 1), and Abs
specifically directed to each peptide also showed strong
cross-reactivity with P. yoelii sporozoites (Table 2).
No IFAT labeling of P. yoelii or P. berghei sporozoites was obtained using human Abs affinity
purified on recombinant protein DG671 or the synthetic peptide SALSA2
from the P. falciparum preerythrocytic SALSA molecule
(3).
|
|
|
LSA3 shares T-cell epitopes with P. yoelii
sporozoite stage.
In a previous study, it was reported that T
cells from chimpanzee Gerda immunized with the LSA3-NRII lipopeptide
could specifically respond to in vitro stimulation by native LSA3,
whereas control nonimmunized chimpanzees did not (1, 2).
We therefore investigated the presence of cross-reactive T-cell
epitopes in the rodent parasite molecule. A strong proliferative
response of T cells derived from an LSA3-immunized chimpanzee was
observed in a dose-dependent manner when a P. yoelii
sporozoite extract was used as antigen (Fig.
3). These cells were not stimulated when
P. berghei sporozoite extracts were used (Fig. 3),
demonstrating the specificity of the T-cell responses induced by
P. yoelii sporozoite extracts.
|
Anti-P. yoelii Abs induced in mice cross-react with P. falciparum LSA3. Conversely, infection of mice with live P. yoelii sporozoites also induced IgG Abs that reacted with the three synthetic peptides LSA3-RE, LSA3-NRI, and LSA3-NRII, with mean ELISA ratios of 7.1, 10, and 7.2, respectively. This cross-reactivity was detectable on day 6 after the infection induced by sporozoites, when the blood parasitemia was only 0.01%. In contrast, in mice infected with parasitized red blood cells, serum taken at day 14 (anti-blood-stage IFAT Ab titer of 5,400) contained no cross-reactive Abs (mean ELISA ratio of <1.5, using each of the three peptides). No cross-reactive Abs were found in sera from mice infected with P. berghei sporozoites (data not shown).
Invasion of P. yoelii sporozoites into mouse hepatocytes is strongly reduced by naturally acquired human anti-LSA3 Abs. Having demonstrated the existence of shared B-cell epitopes between LSA3 and P. yoelii preerythrocytic stages, we examined the effect of anti-LSA3 Abs on in vitro invasion of murine hepatocytes by P. yoelii sporozoites. P. berghei sporozoites were used as control.
Experiments using the two rodent species were conducted in parallel, i.e., performed using a single hepatocyte preparation (Fig. 4). We found 99 to 100% inhibition of P. yoelii sporozoite invasion, when a preparation of human Ab affinity purified against DG729 at an IFAT end point titer as low as 1/2, was used. Inversely, Abs from the non-cross-reactive antigen (SALSA) had little or no effect (<10% inhibition). The inhibitory effect was strain independent, since similar results were obtained when sporozoites from the 265BY strain of the parasite were used (data not shown), but was species specific, since no inhibition was observed with P. berghei sporozoites.
|
Human anti-LSA3 Abs protect mice against an infection with
P. yoelii sporozoites.
The human
affinity-purified anti-DG729 (LSA3) or anti-DG671 (SALSA) Abs were
further tested in passive transfer experiments. Groups of six mice were
used in duplicate experiments. In each group two mice were injected
with sporozoites mixed with anti-DG729 Abs, two were injected with
sporozoites mixed with anti-DG671 Abs, and the last two mice served as
infectivity controls. We found that all mice receiving the anti-DG729
Abs were completely protected, with no parasites detectable in the
blood from day 4 to day 21 postinoculation. Conversely, control mice
who received sporozoites preincubated with anti-DG671 Abs or untreated
sporozoites had a patent parasitemia from day 5, and the infection
followed a normal course (Table 3).
|
| |
DISCUSSION |
|---|
|
|
|---|
Research on the development of vaccines against P. falciparum malaria has been severely hampered by the narrow host specificity of the human parasite (19), which precludes the use of common laboratory animals. This limitation is particularly marked when the preerythrocytic stage antigens are targeted. In this context, homologous antigens of rodent parasite species that are recognized by naturally acquired human Abs would allow one to carry out functional investigations in the more amenable laboratory models. In this article we present evidence that the preerythrocytic LSA3 antigen of P. falciparum, a new and very promising vaccine candidate, has an antigenic homologue in P. yoelii.
The cross-reactivity of human anti-LSA3 Abs, affinity purified against the N terminus of the molecule, was first observed in IFAT assays using P. yoelii sporozoites. This cross-reactivity was further characterized using recombinant proteins and synthetic peptides representative of the whole molecule. Our results suggest that there is an LSA3 analogue in P. yoelii. All the LSA3-specific Abs tested cross-reacted with the three different lines of P. yoelii used in this study. The pattern of expression of this putative analogue was found to be similar to that described for the human parasite P. falciparum (11), namely, strong specific labeling of sporozoite surface and liver schizonts but not of erythrocytic forms. The protein in the rodent parasite also has a molecular mass close to the 200-kDa mass of the K1 strain LSA3 (11). It should be pointed out that LSA3 has a repeated region which is polymorphic in length between different strains; thus, LSA3 of the NF54 strain is 175 kDa.
Our results indicate the presence of shared B- and T-cell epitopes between the P. falciparum LSA3 and a molecule of P. yoelii. At least four distinct B-cell epitopes were found to be shared by LSA3 and its putative homologue in P. yoelii, with one found in the repeat region and three occurring in the nonrepeated domains of the protein. Cross-reactivity at the T-cell level, which has been previously suggested (2), has been confirmed. PBMC from a chimpanzee immunized with the LSA3-NRII peptide, which contains Th and cytotoxic T-lymphocyte epitopes (1), proliferated in a dose-dependent manner in the presence of P. yoelii sporozoites. To our knowledge this is the first molecule described as containing a cross-reactive T-cell epitope between a human and a rodent malaria preerythrocytic antigen. Further, immunoepidemiological and immunization studies have indicated that LSA3 is highly antigenic and immunogenic (1, 2). The same seems to hold true for the P. yoelii homologue, since as few as 150 sporozoites proved sufficient to induce IgG antibodies to several distinct B-cell epitopes.
The most striking feature of the cross-reactivity observed with P. yoelii lies in the biological effect. Thus, naturally acquired human anti-LSA3 Abs inhibit the invasion of hepatocytes by rodent malaria sporozoites. This inhibition is specific and is observed both in vitro and in vivo. Similar in vitro results were found using P. falciparum sporozoites in the inhibition-of-liver-stage-development human hepatocyte assay (V. Pasquetto, unpublished data). The inhibitory activity obtained in vitro is particularly notable for its unusually high level and the low Ab concentrations at which it was obtained. Indeed, these inhibitory levels are among the highest observed in primary hepatocyte cultures (20, 21, 23, 24, 26) and are higher than those obtained so far with human Abs directed to other sporozoite surface antigens (26).
The in vitro invasion inhibition was confirmed by in vivo studies, which are obviously untenable for P. falciparum in humans, and hereby stresses the value of the P. yoelii-LSA3 model. In our experiments anti-LSA3 Abs purified from the sera of clinically protected individuals, with Ab levels as low as 20 µg, were sufficient to provide complete protection to mice against P. yoelii sporozoite challenge. Passive transfer of 1 mg of MAb NYS1 anti-CS protein was employed to obtain 100% protection of mice against a challenge with P. yoelii, but at a lower dose of 125 µg, only 67% protection was obtained (7). In other animal models, protection was achieved in Saimiri monkeys after passive transfer of 2 mg of anti-CS MAb NVS3 directed to the CS protein from Plasmodium vivax (6). Recently Gantt et al. (18) showed that the MAb F3B5 directed against thrombospondin-related anonymous protein repeat did not inhibit the in vivo infectivity of P. yoelii sporozoites even when incubated at concentrations as high as 500 µg/ml. Moreover, polyclonal antisera directed against thrombospondin-related anonymous protein N10, a region that is highly conserved among Plasmodium species that infect mammals (33), also did not reduce the infectivity of sporozoites in vivo (18). Furthermore, it has been shown that the precipitin reaction (CS precipitation) can be induced by Abs directed to the surface of sporozoites (30). This reaction, which immobilizes the sporozoite, inhibits the invasion of the hepatocytes by acting on parasite gliding motility (32). In the present study, we found that human anti-LSA3 Abs induce the same phenomenon on the surface of P. yoelii sporozoites.
Our knowledge of the critical mechanisms involved in protection against the preerythrocytic stages of either human or rodent malaria remains insufficient. The roles of Abs and various T-cell subsets have been indicated in both situations, but the more critical importance of one over the other remains controversial. It is today generally agreed, however, that Abs most likely play a role, but that their effect is incomplete (16, 29). The potential of Abs was reinforced in recent clinical trials of a hybrid CS recombinant protein, termed RTS,S, which have clearly demonstrated that CS subunit vaccines can elicit protective immunity that correlates with high levels of anti-CS antibody and CD4+ T cells in the absence of detectable CD8+ T cells (31). Most of this knowledge is based on anti-CS Abs and to a lesser extent on anti-TRAP-SSP2 or anti-STARP. Few data are available for the LSA3 antigen, which was characterized more recently and which, in contrast to other preerythrocytic malaria molecules, is highly conserved. The underlying mechanism(s) of the protection induced in a reproducible manner in chimpanzees also remains to be elucidated. Results presented here with the P. yoelii LSA3 homologue would suggest that the role of anti-LSA3 Abs against P. falciparum preerythrocytic stages in vivo now deserves to be addressed. In conclusion, this mouse model may be of potential value in the study of the biological activity of immune responses induced by P. falciparum LSA3, where it might be very profitably exploited to assess the actual efficacy elicited by LSA3-based vaccination.
| |
ACKNOWLEDGMENTS |
|---|
We thank Sylvie Mellouk for her contribution to the in vitro studies, Steve Hoffman and Yupin Charoenvit for their generous gift of the anti-CS MAbs employed in this study, and Wijnand Eling for supplying of NF54 P. falciparum sporozoites.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Bio-Medical Parasitology Unit, Institut Pasteur, 28, rue du Docteur Roux, 75015 Paris, France. Phone: 33-1-45 68 85 78. Fax: 33-1-45 68 86 40. E-mail: druilhe{at}pasteur.fr.
Editor: W. A. Petri Jr.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | BenMohamed, L., H. Gras-Masse, A. Tartar, P. Daubersies, K. Brahimi, M. Bossus, A. Thomas, and P. Druilhe. 1997. Lipopeptide immunization without adjuvant induces potent and long-lasting B, T helper, and cytotoxic T lymphocyte responses against a malaria liver stage antigen in mice and chimpanzees. Eur. J. Immunol. 27:1242-1253[Medline]. |
| 2. | BenMohamed, L., A. Thomas, M. Bossus, K. Brahimi, J. Wubben, H. Gras-Masse, and P. Druilhe. 2000. High immunogenicity in chimpanzees of peptides and lipopeptides derived from four new Plasmodium falciparum pre-erythrocytic molecules. Vaccine 18:2843-2855[CrossRef][Medline]. |
| 3. | Bottius, E., L. BenMohamed, K. Brahimi, H. Gras-Masse, J. P. Lepers, M. Aikawa, J. Meis, B. Slierendregt, A. Tartar, A. Thomas, and P. Druilhe. 1996. A novel Plasmodium falciparum sporozoite and liver stage antigen (SALSA) defines major B, Th and CTL epitopes. J. Immunol. 156:2874-2884[Abstract]. |
| 4. | Brahimi, K., J. L. Pérignon, M. Bossus, H. Gras, A. Tartar, and P. Druilhe. 1993. Fast immunopurification of small amounts of specific antibodies on peptides bound to ELISA plates. J. Immunol. Methods 162:69-75[CrossRef][Medline]. |
| 5. | Burns, J. M., L. A. Parke, T. M. Daly, L. A. Cavacini, W. P. Weidanz, and C. A. Long. 1989. A protective monoclonal antibody recognizes a variant-specific epitope in the precursor of the major merozoite surface antigen of the rodent malarial parasite Plasmodium yoelii. J. Immunol. 142:2835-2840[Abstract]. |
| 6. |
Charoenvit, Y.,
W. E. Collins,
T. R. Jones,
P. Millet,
L. Yuan,
G. H. Campbell,
R. L. Beaudoin,
J. R. Broderson, and S. L. Hoffman.
1991.
Inability of malaria vaccine to induce antibodies to a protective epitope within its sequence.
Science
251:668-671 |
| 7. | Charoenvit, Y., S. Mellouk, C. Cole, R. Bechara, M. F. Leef, M. Sedegah, L. F. Yuan, F. A. Robey, R. L. Beaudoin, and S. L. Hoffman. 1991. Monoclonal, but not polyclonal, antibodies protect against Plasmodium yoelii sporozoites. J. Immunol. 146:1020-1025[Abstract]. |
| 8. | Charoenvit, Y., S. Mellouk, M. Sedegah, T. Toyoshima, M. F. Leef, P. De La Vega, R. L. Beaudoin, M. Aikawa, V. Fallarme, and S. L. Hoffman. 1995. Plasmodium yoelii: 17-kDa hepatic and erythrocytic stage protein is the target of an inhibitory monoclonal antibody. Exp. Parasitol. 80:419-429[CrossRef][Medline]. |
| 9. | Clyde, D. F., H. Most, V. McCarthy, and J. P. Vanderberg. 1973. Immunization of man against sporozoite-induced falciparum malaria. Am. J. Med. Sci. 266:169-177[CrossRef][Medline]. |
| 10. | Da Silveira, F. J., L. Sibilli, E. Brunet, and O. Mercereau. 1984. Cloning of cDNAs that code for Plasmodium chabaudi antigens of the erythrocytic forms and crosshybridize with P. falciparum. Mol. Biochem. Parasitol. 8:45-51. |
| 11. | Daubersies, P., A. W. Thomas, P. Millet, K. Brahimi, J. A. M. Langermans, B. Ollomo, L. BenMohamed, B. Slierendregt, W. Eling, A. Van Belkum, G. Dubreuil, J. F. G. M. Meis, C. Guérin-Marchand, S. Cayphas, J. Cohen, H. Gras-Masse, and P. Druilhe. 2000. Protection against Plasmodium falciparum malaria in chimpanzees by immunization with the conserved pre-erythrocytic liver-stage antigen 3. Nat. Med 6:1258-1263[CrossRef][Medline]. |
| 12. |
Del Portillo, H. A.,
S. Longacre,
E. Khouri, and P. H. David.
1991.
Primary structure of the merozoite surface antigen 1 of Plasmodium vivax reveals sequences conserved between different Plasmodium species.
Proc. Natl. Acad. Sci. USA
88:4030-4034 |
| 13. |
Doolan, D. L.,
R. C. Hedstrom,
O. W. Rogers,
Y. Charoenvit,
M. Rogers,
P. de la Vega, and S. L. Hoffman.
1996.
Identification and characterisation of the protective hepatocyte erythrocyte protein 17 kDa gene of Plasmodium yoelii, homolog of Plasmodium falciparum exported protein 1.
J. Biol. Chem.
271:17861-17868 |
| 14. | Druilhe, P., and C. Marchand. 1989. From sporozoite to liver stages: the saga of the irradiated sporozoite vaccine, p. 39-48. In K. McAdam (ed.), New strategies in parasitology. Churchill Livingstone, Edinburgh, United Kingdom. |
| 15. |
Druilhe, P.,
O. Pradier,
J. P. Marc,
F. Miltgen,
D. Mazier, and D. Parent.
1986.
Levels of antibodies to Plasmodium falciparum sporozoite surface antigens reflect malaria transmission rates and are persistent in the absence of reinfections.
Infect. Immun.
53:393-397 |
| 16. | Druilhe, P., L. Renia, and D. A. Fidock. 1998. Immunity to liver stages, p. 513-543. In I. W. Sherman (ed.), Malaria: parasite biology, pathogenesis, and protection. ASM Press, Washington, D.C. |
| 17. | Fidock, D. A., E. Bottius, K. Brahimi, I. I. M. D. Moelans, M. Aikawa, R. N. H. Konings, U. Certa, P. Olafsson, T. Kaidoh, A. Asavanich, C. Guerin-Marchand, and P. Druilhe. 1994. Cloning and characterization of a novel Plasmodium falciparum sporozoite surface antigen, STARP. Mol. Biochem. Parasitol. 64:219-232[CrossRef][Medline]. |
| 18. |
Gantt, S.,
C. Persson,
K. Rose,
A. J. Birkett,
R. Abagyan, and V. Nussenzweig.
2000.
Antibodies against thrombospondin-related anonymous protein do not inhibit Plasmodium sporozoite infectivity in vivo.
Infect. Immun.
68:3667-3673 |
| 19. | Garnham, P. C. C. 1966. Malaria parasites and other haemosporidia. Blackwell Scientific, Oxford, United Kingdom. |
| 20. | Hollingdale, M. R., A. Appiah, P. Leland, V. E. do Rosario, D. Mazier, S. Pied, D. A. Herrington, J. D. Chulay, W. R. Ballou, T. Derks, S. H. Yap, R. L. Beaudoin, and J. P. Verhave. 1990. Activity of human volunteer sera to candidate Plasmodium falciparum circumsporozoite protein vaccines in the inhibition of sporozoite invasion assay of human hepatoma cells and hepatocytes. Trans. R. Soc. Trop. Med. Hyg. 84:325-329[CrossRef][Medline]. |
| 21. | Hollingdale, M. R., E. H. Nardin, S. Tharavanij, A. L. Schwartz, and R. S. Nussenzweig. 1984. Inhibition of entry of Plasmodium falciparum and P. vivax sporozoites into cultured cells: an in vitro assay of protective antibodies. J. Immunol. 132:909-913[Abstract]. |
| 22. | Marchand, C., and P. Druilhe. 1990. How to select P. falciparum pre-erythrocytic antigens in an expression library without defined probe. Bull. W. H. O. 68:158-164. |
| 23. |
Mazier, D.,
S. Mellouk,
R. Beaudoin,
B. Texier,
P. Druilhe,
W. Heckmeyer,
J. Trosper,
C. Paul,
J. Young,
F. Miltgen,
B. Galley,
O. Brandicourt,
Y. Charoenvit,
G. Chedid,
J. P. Chigot, and M. Gentilini.
1986.
Effect of antibodies to recombinant and synthetic peptides on development of Plasmodium falciparum sporozoites in vitro.
Science
231:156-159 |
| 24. | Mellouk, S., N. Berbiguier, P. Druilhe, M. Sedegah, B. Galey, L. Yuan, M. Leef, Y. Charoenvit, C. Paul, S. Hoffman, and R. Beaudoin. 1990. Evaluation of an in vitro assay aimed at measuring protective antibodies against sporozoites. Bull. W. H. O. 68:52-59. |
| 25. | Merrifield, R. B. 1963. Solid-phase peptide synthesis. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-2152[CrossRef]. |
| 26. | Pasqueto, V., D. Fidock, H. Gras, E. Badell, W. Eling, W. R. Ballou, J. Belghiti, A. Tartar, and P. Druilhe. 1997. Plasmodium falciparum sporozoite invasion is inhibited by naturally acquired or experimentally induced polyclonal antibodies to the STARP antigen. Eur. J. Immunol. 27:2502-2513[Medline]. |
| 27. |
Ray, P.,
N. Sahoo,
B. Singh, and F. A. S. Kironde.
1994.
Serum antibody immunoglobulin G of mice convalescent from Plasmodium yoelii infection inhibits growth of Plasmodium falciparum in vitro: blood stage antigens of P. falciparum involved in interspecies cross-reactive inhibition of parasite growth.
Infect. Immun.
62:2354-2361 |
| 28. |
Rogers, W. O.,
A. Malik,
S. Mellouk,
K. Nakamura,
M. D. Rogers,
A. Szarfman,
D. M. Gordon,
A. K. Nussler,
M. Aikawa, and S. L. Hoffman.
1992.
Characterization of Plasmodium falciparum sporozoite surface protein 2.
Proc. Natl. Acad. Sci. USA
89:9176-9180 |
| 29. | Sinnis, P., and V. Nussenzweig. 1996. Preventing sporozoite invasion of hepatocytes. Infect. Agents Dis. 5:182-189[Medline]. |
| 30. |
Stewart, M.,
R. J. Nawrot,
S. Schulman, and J. P. Vanderberg.
1986.
Plasmodium berghei sporozoite invasion is blocked in vitro by sporozoite-immobilizing antibodies.
Infect. Immun.
51:859-864 |
| 31. | Stoute, J. A., K. E. Kester, U. Krzych, B. T. Wellde, T. Hall, K. White, G. Glenn, C. F. Ockenhouse, N. Garcon, R. Schwenk, D. E. Lanar, P. Sun, P. Momin, R. A. Wirtz, C. Golenda, M. Saloui, G. Wortmann, C. Holland, M. Dowler, J. Cohen, and W. R. Ballou. 1998. Long-term efficacy and immune responses following immunization with the RTS,S malaria vaccine. J. Infect. Dis. 178:1139-1144[Medline]. |
| 32. | Sultan, A., V. Thathy, U. Frevert, K. Robson, A. Crisanti, V. Nussenzweig, R. Nussenzweig, and R. Menard. 1997. TRAP is necessary for gliding motility and infectivity of plasmodium sporozoites. Cell 90:511-522[CrossRef][Medline]. |
| 33. | Templeton, T. J., and D. C. Kaslow. 1997. Cloning and cross-species comparison of the thrombospondin-related anonymous protein (TRAP) gene from Plasmodium knowlesi, Plasmodium vivax and Plasmodium gallinaceum. Mol. Biochem. Parasitol. 84:13-24[CrossRef][Medline]. |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»