Erratum for Visvanathan et al., Infect. Immun. 69 (2) 875-884.
This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Visvanathan, K.
Right arrow Articles by Zabriskie, J. B.
Right arrow Search for Related Content
PubMed
Right arrow Articles by Visvanathan, K.
Right arrow Articles by Zabriskie, J. B.

 Previous Article  |  Next Article 

Infection and Immunity, October 2002, p. 5900, Vol. 70, No. 10
0019-9567/02/$04.00+0     DOI: 10.1128/IAI.70.10.5900.2002
Copyright © 2002, American Society for Microbiology. All Rights Reserved.

ERRATUM

Inhibition of Bacterial Superantigens by Peptides and Antibodies

Kumar Visvanathan, Alain Charles, Jason Bannan, Pavel Pugach, Khosrow Kashfi, and John B. Zabriskie

Laboratory of Clinical Microbiology and Immunology, Rockefeller University, New York, New York 10021; Bacteriology Section, American Type Culture Collection, Manassas, Virginia 20110 and Department of Physiology and Pharmacology, City University of New York Medical School, New York, New York 10031

Volume 69, no. 2, p. 875-884, 2001. Page 876, Fig. 1B: For peptide 6345, the sequence should read KKNVTVQELDYKIRKYLVDNKKLYGC; for peptide 6347, the sequence should read CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY; for peptide 6348, the sequence should read CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC.

Infection and Immunity, October 2002, p. 5900, Vol. 70, No. 10
0019-9567/02/$04.00+0     DOI: 10.1128/IAI.70.10.5900.2002
Copyright © 2002, American Society for Microbiology. All Rights Reserved.




This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Visvanathan, K.
Right arrow Articles by Zabriskie, J. B.
Right arrow Search for Related Content
PubMed
Right arrow Articles by Visvanathan, K.
Right arrow Articles by Zabriskie, J. B.

Copyright © 2009 by the American Society for Microbiology.   For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»