Previous Article | Next Article ![]()
Infection and Immunity, August 2003, p. 4749-4758, Vol. 71, No. 8
0019-9567/03/$08.00+0 DOI: 10.1128/IAI.71.8.4749-4758.2003
Copyright © 2003, American Society for Microbiology. All Rights Reserved.
Molecular Immunology, Swiss Tropical Institute, CH-4002 Basel,1 Institute of Organic Chemistry, University of Zurich, CH-8057 Zurich,2 Pevion Biotech Ltd., CH-3018 Bern, Switzerland3
Received 2 December 2002/ Returned for modification 11 February 2003/ Accepted 14 May 2003
|
|
|---|
|
|
|---|
Several merozoite antigens are thought to be able to induce protective antibodies and are currently considered candidate vaccine antigens (22). One of the leading candidates is apical membrane antigen 1 (AMA-1), an 83-kDa protein that is synthesized in mature stages of the parasite and is first localized in the neck of the rhoptries (8, 32). During the course of merozoite release, an additional N-terminally processed 66-kDa form of AMA-1 seems to spread around the merozoite surface (30, 32). Homologues of AMA-1 have been found in all Plasmodium species examined so far, and the protein seems to play an important role during the invasion of erythrocytes and in blood-stage growth (39, 40). Several passive and active immunization studies have indicated that AMA-1 is involved in eliciting protective immune responses (2, 7, 9, 10, 11, 20, 31, 45) and serves as a target for invasion-blocking antibodies (10, 11, 17, 19, 20).
AMA-1 is a type I integral membrane protein of low abundance. The overall structure of its ectodomain can be divided into subdomains I, II, and III. The structure of the protein is stabilized by eight intramolecular disulfide bonds (16) formed between 16 conserved (4, 24, 43) cysteine residues. The epitopes recognized by protective antibodies are not well characterized, but they seem to be primarily directed against conformational epitopes, since reduced and alkylated AMA-1 gives poor protection (2) and is poorly recognized by hyperimmune serum from individuals living in regions where malaria is endemic (17). The epitope recognized by a single merozoite invasion-blocking anti-P. falciparum AMA-1 monoclonal antibody (MAb) (20) has not been characterized. Other AMA-1 binding MAbs did not inhibit invasion (6), indicating that the fine specificity of an anti-AMA-1 antibody determines its ability to impair the function of the target protein. Similarly, it has been found that antibodies specific for P. falciparum merozoite surface protein 1 (MSP-1) can have invasion-inhibitory activity, be ineffective, or block the activity of inhibitory antibodies (41). In the present report, we provide evidence that it is possible to elicit parasite growth-inhibitory antibodies with a virosomal formulation of a synthetic peptidomimetic derived from loop I in domain III of AMA-1.
|
|
|---|
![]() View larger version (30K): [in a new window] |
FIG. 1. Structures of synthetic peptides used in this study, including AMA49-L1, AMA49-C1, and AMA49-L2, as well as the library of cyclic template-bound peptides each containing 12 residues from AMA-1. The sequences contained within each cyclic peptide are indicated in Table 2. The preferred conformations of each cyclic peptide are so far unknown. In AMA-1446-490, the amino acid residues GGC at the N terminus and G at the C terminus were added for reasons of synthesis and do not correspond to the numbering of the AMA-1 amino acid sequence. Temp., template (formula as shown in the figure).
|
|
View this table: [in a new window] |
TABLE 1. Mass spectrometric characterization of peptides synthesized in this worka
|
(ii) AMA49-C1. AMA49-C1 was prepared in the same way except that succinyl-1,3-dipalmitoyl-2-glycerophosphatidylethanolamine (sPE-succ-OH) was used (Fig. 1), and in the final step the conjugate (4 mg) was oxidized in ammonium acetate buffer (50 mM, pH 8) and 2,2,2-trifluoroethanol (1:1,100 ml) for 4 days at room temperature. After addition of AcOH (100 µl) and lyophilization, AMA49-C1 was purified by HPLC as above for AMA49-L1. The formation of the disulfide bridge was confirmed by a negative Ellman test and by attempted derivatization with NEM, which gave no bis-NEM derivative by HPLC-mass spectroscopy. From the mass spectrum, it was clear that only the monomeric form of AMA49-C1 was obtained.
(iii) AMA49-L2. For the synthesis of AMA49-L2, the dithiol (6 mg) was alkylated with iodoacetamide (43 µmol) in a mixture (5:4) of phosphate buffer (0.1 M, pH 7.5) and trifluoroethanol. AMA49-L2 was purified by HPLC on a C4 column with a gradient of 10 to 100% MeCN-water with 0.1% TFA. The purity was >95% by analytical HPLC. Electrospray mass spectrometry showed the expected mass (Table 1).
(iv) AMA1446-462, AMA1452-472, AMA1462-482, and AMA1467-490. The linear peptides AMA1446-462, AMA1452-472, AMA1462-482, and AMA1467-490 were prepared by standard Fmoc solid-phase peptide synthesis (see above), purified by reverse-phase HPLC on a C18 column and a gradient of MeCN in water with 0.1% TFA, and characterized by amino acid analysis and electrospray mass spectrometry (Table 1).
(v) Library of 12-mers.
A library of 35 12-mer cyclic peptides which scan the AMA444-489 sequence (Fig. 1 and Table 2) was prepared by methods that will be described in detail elsewhere. Each mimetic was
95% pure by HPLC, and the structure was confirmed by electrospray mass spectrometry. The primary structure of all synthesized peptides was based on the AMA-1 domain III sequence of P. falciparum strain K1 (accession number U33279).
|
View this table: [in a new window] |
TABLE 2. Reactivity of anti-AMA49-C1 MAbsa
|
Mouse immunogenicity studies. BALB/c mice were immunized intramuscularly with 0.1 ml of the commercial whole-virus influenza vaccine Inflexal Berna (Berna Biotech, Bern, Switzerland). At least 3 weeks later, they were immunized with peptide-loaded IRIVs at intervals of at least 2 weeks. Blood was collected before each immunization and 2 weeks after the final injection.
ELISA. Enzyme-linked immunosorbent assay (ELISA) analyses with peptide-phosphatidylethanolamine conjugates were performed essentially as described previously (28). Briefly, Polysorp plates (Nunc, Fisher Scientific, Wohlen, Switzerland) were coated overnight at 4°C with 100 µl of a 10-µg/ml solution of AMA-1 peptide-phosphatidylethanolamine conjugate in PBS (pH 7.2). Wells were then blocked with 5% milk powder in PBS for 30 min at 37°C, followed by three washes with PBS containing 0.05% Tween 20. Plates were then incubated with serial dilutions of antimimetic mouse serum or anti-AMA49-L1 monoclonal antibodies (MAbs) in PBS containing 0.05% Tween 20 and 0.5% milk powder for 2 h at 37°C. After being washed, plates were incubated with alkaline phosphatase-conjugated goat anti-mouse gamma heavy-chain antibodies (Sigma, St. Louis, Mo.) for 1 h at 37°C. After being washed again, phosphatase substrate solution (1 mg of p-nitrophenyl phosphate [Sigma] per ml in a pH 9.8 buffer solution containing 10% [vol/vol] diethanolamine and 0.02% MgCl2) was added, and the plates were incubated in the dark at room temperature until the colorimetric reaction had progressed sufficiently. The optical density was measured at 405 nm on a Titertek Multiscan MCC/340 reader (Labsystems, Helsinki, Finland).
In competition assays, peptide-phosphatidylethanolamine-coated plates were incubated for 2 h with MAbs in the presence of increasing concentrations of competitor peptides. Isotypes of anti-AMA49 MAbs were determined by detecting MAbs bound to peptide-phosphatidylethanolamine-coated plates with alkaline phosphatase-conjugated goat antibodies specific for mouse immunoglobulin
1,
2a,
2b,
3,
, or
chains (Southern Biotechnology, Birmingham, Ala.).
Indirect immunofluorescence assay. Multiwell immunofluorescence microscopy slides (Flow Laboratories, Baar, Switzerland) were treated with 0.01% poly-L-lysine (Sigma) at room temperature for 30 min and washed five times with RPMI basal salts medium (Gibco-BRL, Basel, Switzerland). Erythrocytes from in vitro cultures (26) of P. falciparum strain K1 with a parasitemia of between 5 and 10% were washed twice in RPMI and resuspended in RPMI and 2 volumes of a solution containing 4% formaldehyde and 0.1% Triton X-100. From this cell suspension, 30 µl was added to each well, incubated at room temperature for 30 min, and washed five times with PBS. Wells were incubated for 30 min at room temperature with blocking solution containing 1% fatty acid-free bovine serum albumin in PBS.
Immunostaining was performed by incubating the wells with 25 µl of an appropriate antibody or serum dilution in blocking solution in a humid chamber for 1 h at room temperature. After five washes with blocking solution, 25 µl of 5-µg/ml indocarbocyanine dye-conjugated affinity-pure F(ab')2 fragment goat anti-mouse IgG heavy-chain antibodies (Jackson ImmunoResearch Laboratories, West Grove, Pa.), diluted in blocking solution containing 0.01 mg of Hoechst dye no. 33256 (Sigma) per ml, were added to the wells and incubated for 1 h at room temperature. Finally, the wells were washed five times, mounted with mounting solution (90% [vol/vol] glycerol containing 0.1 M Tris-Cl [pH 8.0] and 2 mg of o-phenylenediamine per ml) and covered with a coverslip. Antibody binding and DNA staining were assessed by fluorescence microscopy on a Leitz Dialux 20 fluorescence microscope and documented with a Leica DC200 digital camera system.
Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and immunoblotting. Parasite lysates were prepared essentially as described previously (26) by saponin lysis of P. falciparum K1-infected erythrocytes. In brief, cultured parasites were washed three times with serum-free RPMI medium. Pelleted infected red blood cells were lysed by mixing with a large volume (adjusted to 5% hematocrit) of 0.015% (wt/vol) saponin in 150 mM NaCl and 15 mM sodium citrate (pH 7.0) and incubated on ice for 20 min. Finally, the pelleted parasites were resuspended in 3 volumes of SSC buffer (0.15 M NaCl plus 0.015 M sodium citrate) and stored at -80°C until further use.
A total of 50 µl of parasite lysate was solubilized in an equal volume of 2x loading buffer (1.7 ml of 0.5 M Tris-HCl [pH 6.8], 2 ml of glycerol, 4.5 ml of 10% sodium dodecyl sulfate, 1 ml of ß-mercaptoethanol, 0.8 ml of bromophenol blue [0.3%, wt/vol]) and heated to 95°C for 10 min. Proteins were separated on an SDS-10% PAGE minigel. Separated proteins were electrophoretically transferred to a nitrocellulose filter (Protran Nitrocellulose, BA85; Schleicher & Schuell) by semidry blotting. Blots were blocked with PBS containing 5% milk powder and 0.1% Tween 20 overnight at 4°C. The filter was cut into strips and incubated with appropriate dilutions of immune serum in blocking buffer for 2 h at room temperature. Filter strips were then washed three times for 10 min in blocking buffer and incubated at room temperature for 1 h with alkaline phosphatase-conjugated goat anti-mouse
heavy-chain antibodies diluted 1:30,000 in blocking buffer (Sigma, St. Louis, Mo.). After being washed again, blots were finally developed with 5-bromo-4-chloro-3-indolylphosphate (Bio-Rad, Reinach, Switzerland) and nitroblue tetrazolium (Bio-Rad) to visualize bands.
Generation of hybridomas and production of MAbs. Hybridomas were generated from spleen cells of mice 3 days after a booster immunization with AMA49-C1-loaded IRIVs with PAI mouse myeloma cells as a fusion partner. Hybrids were selected in hypoxanthine-aminopterin-thymidine medium, and cells that secreted anti-AMA49-L1 MAbs were identified by ELISA. For large-scale MAb production, hybridoma cell lines were cultured in 1-liter spinner bottles, and MAbs were purified by protein G affinity chromatography. Purified MAbs were dialyzed against PBS, aliquoted, and stored at -80°C.
Parasite culture and in vitro growth inhibition assay. P. falciparum strain K1 was cultured essentially as described previously (26). The culture medium was supplemented with 0.5% AlbuMAX (Gibco, Paisley, Scotland) as a substitute for human serum (12). Synchronization of cultures was achieved by sorbitol treatment as described previously (23). Serogroup A+ erythrocytes for passages were obtained from the Swiss Red Cross (Basel, Switzerland).
For in vitro growth inhibition assays, synchronous late trophozoites or schizonts were diluted with fresh red blood cells to give a parasitemia of 0.5% and mixed with purified MAb. The final hematocrit in cultures was adjusted to 0.5%. Each culture was set up in sextuplicate in 96-well flat-bottomed culture plates. After 96 h, the plates were centrifuged at 180 x g for 5 min, and the culture supernatants were discarded. Pelleted erythrocytes were resuspended in 200 µl of PBS supplemented with 15 µg of hydroethidine fluorescent vital stain (Polysciences Inc., Warrington, Pa.) per ml and incubated at 37°C for 30 min. The erythrocytes were washed twice with PBS, resuspended in 400 µl of PBS, and analyzed in a FACSscan flow cytometer (Becton Dickinson, San Jose, Calif.) with CellQuest 3.2.1fl software. The hydroethidine emission was detected in the FL2 channel by logarithmic amplification, and the erythrocytes were gated on the basis of their forward and side scatters. A total of 30,000 cells per sample were analyzed. Percent inhibition was calculated from the geometric mean parasitemias of sextuplicate test and control wells as 100 x [(control - test)/control]. Statistical significance was calculated by a two-sided t test. Confidence intervals (P < 95%) were calculated by antilogging the confidence limits calculated on the log scale.
|
|
|---|
![]() View larger version (18K): [in a new window] |
FIG. 2. Representation of the structure of loop 1 from domain III of AMA-1. The image was made with the PDB file 1HN6, which includes residues 436 to 545 of domain III. The sequence stretch incorporated into the synthetic AMA49 molecules (AMA446-490) is shown as a black cylinder. The residues showing dimorphism (D/N448, K/M451, and K/I485) are each depicted by a black ball.
|
![]() View larger version (26K): [in a new window] |
FIG. 3. AMA49-L1- (A), AMA49-C1- (B), and AMA49-L2- (C) specific IgG ELISA titers after three immunizations of mice with AMA49-L1-, AMA49-C1-, and AMA49-L2-loaded IRIV, respectively. Responses of individual mice are shown. Preimmune serum samples showed no significant reactivity with the corresponding immunogen, and for each group one typical preimmune serum (open circles) is shown.
|
![]() View larger version (140K): [in a new window] |
FIG. 4. Immunofluorescence staining of mature schizonts of P. falciparum strain K1. (A and C) Parasite DNA control staining with Hoechst dye 33258. (B) Characteristic AMA-1 immunostaining with anti-AMA49-L1 immune serum (diluted 1:100). (D) Lack of staining with preimmune serum (diluted 1:100). Representative results with serum samples derived from one of the immunized mice are shown. Sera from all other AMA49-L1-, AMA49-C1-, and AMA49-L2-immunized mice yielded comparable immunofluorescence assay staining patterns.
|
![]() View larger version (78K): [in a new window] |
FIG. 5. Western blot analysis of the reactivity of anti-AMA49-L1 (A), anti-AMA49-C1 (B), and anti-AMA49-L2 (C) antisera with P. falciparum K1 blood stage lysates as the antigen. Sera yielded a double band pattern (indicated by arrows) characteristic of full-length AMA-1 and its major processing product (83 and 66 kDa, respectively). Each lane represents serum from one individual mouse. No staining was observed with the corresponding preimmune serum samples. All serum samples were used at a dilution of 1:100.
|
For a detailed analysis of the humoral immune response, AMA49-C1-specific mouse B-cell hybridomas were generated. All 11 hybridoma clones obtained secreted IgG:
(10 MAbs were IgG1; MAb DV3 was IgG2a) that reacted in the ELISA with both the cyclic and the linear peptides with comparable efficacy. These 11 MAbs all stained blood stage parasites of strain K1 in the immunofluorescence assay (data not shown).
Competition ELISA experiments with a set of four overlapping linear peptides, AMA446-462, AMA452-472, AMA462-482, and AMA472-490 (Fig. 1), were used for epitope mapping and differentiated four groups of antibodies (Table 2). Antigen binding of MAbs DV2 and DV6 was blocked by AMA446-462, MAb DV7 was blocked by both AMA446-462 and AMA452-472, MAbs DV5 and DV8 were blocked by AMA452-472, and MAbs DV1, DV3, DV4, DV9, DV10, and DV11 were blocked by AMA462-482. None of the antibodies was blocked by the C-terminal sequence AMA472-490.
A library of 35 cyclic peptides, each containing 12 residues scanning the AMA444-489 sequence and each with an offset of one amino acid, were used for more detailed epitope mapping (Fig. 1 and Table 2). These peptides were conformationally restrained by cyclization through linkage to a dipeptide template comprising a D-proline and an L-4-aminoproline conjugated to succinyl-l-oleyl-3-palmitoyl-2-glycerophosphatidylethanolamine (succPE). In the ELISA, both MAbs DV2 and DV6 inhibited by AMA446-462 bound to none of the short cyclic peptides. MAb DV7 bound to the consecutive cyclic peptides comprising residues 450 to 461 through 455 to 466, which share the sequence E455RESKRI461 that is also present in the overlap of the two long inhibitory peptides AMA446-462 and AMA452-472. MAbs DV5 and DV8 bound to cyclic peptides 453 to 464 through 459 to 470, which share the sequence K459RIKLN464 located in the center of the inhibitory peptide AMA452-472. Additional binding of both MAbs to the nonconsecutive cyclic peptide 477 to 488 and of MAb DV5 to cyclic peptide 474 to 485 is indicative of a discontinuous epitope.
All six MAbs that were inhibited by AMA462-482 exhibited binding to the consecutive peptides 464 to 475 through 467 to 478, which share the sequence D467DEGNKKII475 located in the center of the long inhibitory peptide AMA462-482. MAb DV1 reacted in addition with the overlapping peptide 462 to 473. In the case of MAb DV3, the reactivity with peptide N466DDEGNKKIIAP477 was outstanding. With the other four MAbs, DV4, DV9, DV10, and DV11 reactivity patterns with nonoverlapping peptides indicated recognition of a discontinuous epitope. All four MAbs showed reactivity with peptide 456 to 467, which only overlaps at position D467 with the putative central D467DEGNKKII475 recognition sequence. In addition, MAbs DV4 and DV9 also bound to the nonconsecutive peptides 474 to 485 and 478 to 489 and to the peptides 462 to 473 and 463 to 474, which share the sequence D467DEGNKK473 with the central recognition sequence.
While immunofluorescence assay cross-reactivities with P. falciparum strains expressing natural sequence variants of AMA446-490 (strain 3D7, D448M451K485; strain RPF2, D448K451I485; and strain FC27, N448M451K485) were observed, none of the MAbs reacted with Plasmodium berghei blood stage parasites expressing a shorter loop 1 sequence (YKNKINEEIKVLNKNISNGNNSIEFPRIFISTDKNSLNC) with 59% identity to the P. falciparum sequence (data not shown).
Mice were immunized with IRIV loaded with phosphatidylethanolamine conjugates of each of the cyclic 12-mer peptides in order to analyze whether some of them could act as mimotopes of AMA-1 surface loops and elicit parasite-binding antibodies. While all 35 structures elicited significant antibody titers against the respective immunizing peptide sequence itself, only serum samples raised against AMA458-469 (containing the central recognition unit K459RIKLN464 of MAbs DV5 and DV8) and AMA464-475 (containing the central recognition unit D467DEGNKKII475 of MAbs DV1, DV3, DV4, DV9, DV10, and DV11) were weakly cross-reactive with blood stage parasites in the immunofluorescence assay (data not shown). Hyperimmune serum samples from individuals living in regions where malaria is endemic were reactive with all forms of AMA446-490 in the ELISA but showed either no or only very weak binding to the 35 cyclic 12-mer peptides (data not shown).
When MAbs DV5 and DV11, representing the two major fine specificities, were tested in a P. falciparum in vitro growth inhibition assay, both exhibited substantial inhibitory activity (Fig. 6). A 95.3% reduction of parasite growth was observed after addition of MAb DV5 at a final concentration of 300 µg/ml (average of five independent sextuplicate experiments). MAb DV11 also exhibited a significant but lower growth-inhibitory activity, while an isotype-matched control MAb had no effect. Taken together, these data clearly demonstrate that it is possible to elicit parasite binding and in vitro growth-inhibitory antibodies by immunization with AMA-1446-490 in combination with IRIV as a human-compatible antigen delivery system.
![]() View larger version (25K): [in a new window] |
FIG. 6. In vitro parasite growth-inhibitory activity of anti-AMA49 MAbs. (A) MAb DV5; (B) MAb DV11; (C) isotype-matched control antibodies. Each symbol represents the mean of an independent sextuplicate experiment, and error bars indicate the 95% confidence intervals (P < 0.05, two-sided t test).
|
|
|
|---|
An analysis of tryptic fragments of P. chabaudi adami AMA-1 recently identified a loop-like structure within the putative domain I as a target of antibodies from hyperimmune mouse serum samples (37). A synthetic 45-mer loop mimetic incorporating this element was found to elicit AMA-1 binding antibodies. However, these did not protect P. chabaudi adami-challenged mice in passive immunization experiments. Since domain I is the most diverse region of AMA-1 (25, 46), an AMA-1 vaccine component which lacks this domain may be preferable in order to direct the immune response to a region(s) that contain more conserved epitopes (17). Since the production of large batches of clinical-grade recombinantly expressed AMA-1 has been notoriously difficult, we are investigating the possibility of developing a synthetic peptide-based AMA-1 vaccine formulation. We demonstrate in this report that it is possible to elicit parasite growth-inhibitory antibodies with a virosomal formulation of a peptide comprising the sequence of loop I from domain III of P. falciparum AMA-1. In agreement with these findings, it has recently been shown that epitopes in domain III are targets of inhibitory human antibodies (29).
The development of peptide-based vaccines is hampered both by the poor immunogenicity of many peptides and by a lack of conformational similarity between small linear peptides and the corresponding sequence in the native target protein. In an attempt to overcome both problems, we are evaluating the use of a human-compatible delivery system comprising IRIVs in synthetic peptide vaccine design (28, 34). IRIVs are spherical, unilammelar vesicles prepared by detergent removal from a mixture of natural and synthetic phospholipids and influenza virus surface glycoproteins. They have been shown to act as an efficient and highly effective means of enhancing the immune response to a variety of antigens, illustrating their broad suitability as a vaccine delivery system (14).
The hemagglutinin membrane glycoprotein of influenza virus plays a key role in the mode of action of IRIVs. This major antigen of influenza virus is a fusion-inducing component which facilitates antigen delivery to immunocompetent cells. In the case of the IRIV-based hepatitis A vaccine Epaxal-Berna, which is the first licensed vaccine in which IRIVs are used as a delivery system for a non-influenza virus antigen, the hepatitis A virus antigen spontaneously binds to the IRIVs. For smaller synthetic antigens, we have developed and evaluated a method to link the antigenic molecule to a phospholipid (phosphatidylethanolamine) and to integrate the phosphatidylethanolamine-antigen conjugates into the virosomal membrane during the virosome reconstitution process (28, 34). When we compared a virosome formulation loaded with a phosphatidylethanolamine conjugate of a cyclic peptide mimotope of the repeat region of the P. falciparum circumsporozoite protein with an alum-adjuvanted mimotope-multiple antigenic peptide construct, we found that both formulations elicited comparable levels of antimimotope antibody responses in mice. However, only the antibodies against the virosomal formulation bind effectively to the parasites, indicating that phosphatidylethanolamine-coupled antigens are located in a more native-like state on the surface of the virosomes. Apparently, adsorption to alum dramatically disturbs the conformation of the mimetic (28).
Several lines of evidence indicate that for an AMA-1 vaccine, the correct conformation is critical. In view of this, our finding that a linear and a cyclized version of the AMA-1446-490 sequence had comparable properties is noteworthy. It remains to be seen whether different cyclic forms of this peptide may generate improved immune responses. In any case, the results may indicate that intramolecular interactions lead to a correct folding of the linear peptide and that the anchoring to the surface of IRIVs has no deleterious effects on this process. Apparently, the solution structure of the AMA-1 domain III, determined by nuclear magnetic resonance spectroscopy, consists of a disulfide-stabilized core region including all three disulfide bonds, but also contains significant regions of disorder (29). Our epitope analyses of growth-inhibitory anti-AMA49 MAbs with a library of 12-residue cyclic peptides covering the AMA444-489 sequence provided evidence that at least some of the MAbs may recognize discontinuous epitopes. Since discontinuous epitopes may contain short stretches of continuous sequences (1, 3, 38), analyses with sets of overlapping peptides are suitable to define both continuous linear epitopes and parts of discontinuous epitopes (15, 41). Our analyses indicate that K459RIKLN464 and D467DEGNKKII475 represent sequence stretches of discontinuous epitopes recognized by inhibitory anti-AMA-1 MAbs.
AMA-1 lacks tandem repeat sequences found in many other P. falciparum antigens. However, a significant degree of sequence diversity is observed, which may reflect diversifying selection pressure from naturally acquired immune responses (9, 13, 33, 42). Most of the polymorphic or dimorphic amino acid residues of the relatively conserved domain III are located far apart from each other in the primary sequence but may cluster in the region of the disulfide core in the three-dimensional structure of the molecule (29). This is also the case for the three variable residues (D448, K451, and K485) present in the AMA-1446-490 sequence analyzed here. The virosomal formulation of this peptide seems to focus the antibody response primarily to conserved loop structures away from this core region. Cross-protection obtained with antibodies raised against recombinantly expressed AMA-1 has provided evidence for the existence of such common protective epitopes (17, 21). Taken together, our results indicate that the loop I sequence from domain III of AMA-1 represents a suitable component of an IRIV-based multiantigen multistage synthetic peptide malaria vaccine candidate.
The authors in Zurich thank the World Health Organization for financial support through the UNDP/World Bank/WHO special program for research and training in tropical diseases.
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2010 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»