Previous Article | Next Article 
Infection and Immunity, December 2005, p. 8017-8026, Vol. 73, No. 12
0019-9567/05/$08.00+0 doi:10.1128/IAI.73.12.8017-8026.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
Phase I Malaria Vaccine Trial with a Long Synthetic Peptide Derived from the Merozoite Surface Protein 3 Antigen
Régine Audran,1,2
Michel Cachat,1
Floriana Lurati,1
Soe Soe,3
Odile Leroy,4
Giampietro Corradin,2
Pierre Druilhe,3 and
François Spertini1*
Division of Immunology and Allergy, Centre Hospitalier Universitaire Vaudois, Lausanne, Switzerland,1
Institute of Biochemistry, University of Lausanne, Epalinges, Switzerland,2
Biomedical Parasitology Unit, Pasteur Institute, Paris, France,3
European Malaria Vaccine Initiative, Center of International Health, Bergen University, Bergen, Norway4
Received 9 June 2004/
Returned for modification 15 August 2004/
Accepted 17 August 2005

ABSTRACT
The C-terminal conserved region of
Plasmodium falciparum merozoite
surface protein 3 (MSP3) is the trigger antigen of a protective
immune response mediated by cytophilic antibodies. In an open,
randomized, two-adjuvant (Montanide ISA 720, aluminum hydroxide)
phase I clinical trial we evaluated the safety and immunogenicity
of increasing doses of a long synthetic peptide construct spanning
the conserved region of MSP3 targeted by biologically active
antibodies (MSP3-LSP). Thirty-five healthy volunteers were randomized
to receive three subcutaneous injections on days 0, 30, and
120. Of the 100 injections given, 10 caused severe local reactions,
62 caused transient mild to moderate local reactions, and 28
caused no reaction. On the basis of preestablished exclusion
criteria, use of the Montanide formulation led to withdrawal
of five volunteers after the second injection. This led to a
reduction in the subsequent vaccine doses in four of the groups.
No vaccine-related serious adverse events occurred throughout
the trial. After the third injection, volunteers displayed a
marked specific anti-MSP3-LSP antibody response (23/30 individuals,
compared with 29/34 individuals for plasma from an area where
malaria is endemic), an anti-native MSP3 antibody response (19/30
individuals), a T-cell-antigen-specific proliferative response
(26/30 individuals), and gamma interferon production (25/30
individuals). In conclusion, the MSP3-LSP vaccine was immunogenic
with both adjuvants, although it was unacceptably reactogenic
when it was combined with Montanide. The potential usefulness
of the candidate vaccine is supported by the induction of a
strong cytophilic response (i.e., the type of anti-MSP3 antibodies
involved in antibody-dependent, monocyte-mediated protective
mechanisms in areas where malaria is endemic).

INTRODUCTION
In view of the high morbidity and mortality rates due to
Plasmodium falciparum and in view of the progression of drug resistance
that threatens treatment efficacy, populations living in areas
where this organism is endemic, especially children, are in
great need of novel effective antimalaria control measures,
such as an antimalaria vaccine. Merozoite surface protein 3
(MSP3), an antigen associated with the membrane of the free
blood-stage parasite, is the first vaccine candidate selected
on the basis of a mechanism found to correlate with protection
in humans, i.e., the induction of cytophilic antibodies that
are the key agents of antibody-dependent, monocyte-mediated
inhibition of growth of the parasite. Indeed, previous studies
have demonstrated that immunoglobulin G (IgG) from individuals
who are immune to malaria could passively transfer immunity
to naive infected recipients (
37). Furthermore, IgG cooperates
with monocytes in a mechanism of antibody-dependent inhibition
of parasite growth (ADCI) in vitro (
6,
8,
15). Protected individuals
produce mostly cytophilic antimalaria antibodies (IgG1 or IgG3),
whereas nonprotected subjects produce mostly IgG2 and IgM (
1,
32,
40). The C-terminal region of MSP3, which is highly conserved
in various
P. falciparum isolates, was identified as the target
of these biologically active antibodies (
33,
34,
39). In an
immunocompromised mouse model of
P. falciparum infection, the
transfer of both monocytes and anti-MSP3
211-237 antibodies induced
rapid clearance of parasites (
3). MSP3-based vaccines have been
shown to induce strong protection against
P. falciparum challenge
in primates (
10,
11,
21). More recently, three peptides (peptides
b, c, and d) of six peptides from the C-terminal region of MSP3
were used to affinity purify antibodies that possessed ADCI
activity from sera obtained from a population in which malaria
is endemic (
39). The region of MSP3 containing these peptides
was selected as a relatively small conserved region that might
be useful as a vaccine. Our previous experience with synthesis
of long polypeptides (>100 amino acids) showed that we could
produce good-manufacturing-procedure material quickly and efficiently
for clinical studies (
13,
28). Long synthetic peptides (LSP)
have been shown to be safe and immunogenic in preclinical (
2,
5,
26,
27,
36,
44) and clinical (
20,
28,
45) trials and, therefore,
should be considered good candidates for a phase I trial.

MATERIALS AND METHODS
Study design.
This study was an open-labeled, dose range study designed to
assess the safety and immunogenicity of four vaccine dose regimens
combined with two different adjuvants. Six groups of six subjects
received three injections of either 10, 30, 100, or 300 µg
of peptide in Montanide ISA 720 (groups M10-10-10, M30-30-30,
M100-100-100, and M300-300-300, respectively) or 30 or 100 µg
of peptide in aluminum hydroxide (groups A30-30-30 and A100-100-100,
respectively). Volunteers, who were males and females between
18 and 45 years old, were excluded if they had any preexisting
acute or chronic medical condition or evidence of abnormality
in clinical or laboratory findings, were pregnant, had a previous
history of malaria, resided in an area where malaria is endemic
for the previous 6 months and throughout the study, or had a
positive antibody response to MSP3-LSP as determined by an enzyme-linked
immunosorbent assay (ELISA). Informed consent was obtained from
all volunteers before admission into the study, which was approved
by the Ethical Review Board of the Faculty of Medicine, Lausanne,
Switzerland, and was authorized by the Swiss Regulation Authorities.
Thirty-six volunteers were enrolled in the study, and an escalating
dose schedule, starting with a 10-µg MSP3-LSP dose, was
used. In the absence of serious adverse effects (AEs) after
the second injection, the next higher dose schedule was initiated.
Apart from serious adverse events as defined by
Guidelines for Good Clinical Practice (
19), a local erythema that was more
than 10 by 10 cm and/or an induration that was more than 5 cm
in diameter was defined as an adverse effect, which led to withdrawal
of patients from further immunization (unacceptable local reaction).
Peptides.
The vaccine peptide MSP3-LSP corresponded to a fully conserved region covering amino acids 181 to 276 (sequence, RKTKEYAEKAKNAYEK AKNAYQKANQAVLKAKEASSYDYILGWEFGGGVPEHKKEENMLSHL YVSSKDKENISKENDDVLDEKEEEAEETEEEELE) of the C-terminal region of MSP3 (length, 386 amino acid) from P. falciparum strain Fc27 (29). The peptide was synthesized, purified, bottled, and lyophilized by following GMP procedures (batch 00FS023; RMF Dictagene SA, Epalinges, Switzerland; Sedac-Therapeutics, Lille, France) and was tested for stability and toxicity (sterility, endotoxin content, apyrogenicity), as well as for immunogenicity in mice. In humans, seven hyperimmune sera from Ivory Coast were shown to be able to recognize the MSP3-LSP (C. Oeuvray and P. Druilhe, unpublished data). The MSP3 210-380 protein (a kind gift of M. Theisen, Statens Seruminstitut, Copenhagen, Denmark) was used as an alternative target in antibody binding assays and consisted of a recombinant MSP3 polypeptide (rMSP3) produced in Escherichia coli, corresponding to the C-terminal region of MSP3 and covering MSP3 peptides b, c, and d (33). The following four overlapping synthetic peptides spanning 86% of MSP3-LSP were used to identify immunogenic regions by proliferative assays: MSP3-a 194-217 (HERAKNAYQKANQAVLKA KEASSY), MSP3-b211-237 (AKEASSYDYILGWEFGGGVPEHKKEEN), MSP3-c 230-257 (PEHKKEENMLSHLYVSSKDKENISKENE), and MSP3-d 238-276 (MLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELE).
Vaccine formulation and injection.
Vaccine formulations of MSP3-LSP in combination with Montanide ISA 720 and aluminum hydroxide were prepared extemporaneously as follows. (i) Peptide MSP3-LSP was resuspended in 300 µl sterile 0.9% NaCl (Bichsel AG, Interlaken, Switzerland) and mixed with 700 µl Montanide ISA-720 (batch 95041; a kind gift from SEPPIC, Paris, France), a stable water-in-oil emulsion was formed using a 10-ml syringe (by pulling and pushing 10 times) at room temperature, and injection was performed within 5 h. (ii) The peptide was dissolved in 0.6 ml 0.9% NaCl, gently mixed with 0.6 ml aluminum hydroxide [Al(OH)3; 2 mg/ml in saline; batch 281256-01; Berna, Swiss Serum and Vaccine Institute, Bern, Switzerland], and left for 15 min at room temperature for adsorption of peptide on aluminum hydroxide (99% adsorption as measured by high-performance liquid chromatography). Injection (1 ml) was performed within 5 h via the subcutaneous route in the deltoid area on alternate sides at 0, 1, and 4 months (±10 days). The subcutaneous route was chosen to obtain the optimal conditions for surveillance of reactivity.
Safety assessment.
The assessments of safety included evaluations of reactogenicity (local and systemic reactions), tolerance (effect of vaccination on basic daily activities), and biological safety (red blood cells, hemoglobin, hematocrit, mean corpuscular volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, platelets, white blood cells with differential counts, potassium, sodium, aspartate aminotransferase, alanine aminotransferase, total bilirubin, alkaline phosphatase, gamma glutamyl-transferase, creatinin, glucose, and urine analysis). Blood samples (a total of 350 ml in 12 months) were collected at months 0, 1, 2, 4, 5, 9, and 12 (50 ml at each visit; samples were taken immediately before vaccine injection when the two times coincided). A complete physical examination was done at the screening visit and at months 5, 12, and 18.
After each vaccination, the intensity, duration, and severity of any local or systemic reaction were monitored immediately during the first hour and during the two following days (see Table 3). In addition to physician observations, volunteers were asked to report adverse events and temperature (using digital thermometers) for 48 h following injection. The severity of adverse events (local or systemic AEs) was defined as mild (grade 1), moderate (grade 2), severe (grade 3), or serious (resulting in any of the following outcomes: death, a life-threatening experience, hospitalization, a persistent disability or incapacity, or any AEs requiring medical or surgical intervention to prevent one of the outcomes listed in this definition). Grading of pain (intensity) at the injection site was based on a subjective evaluation score ranging from 0 to 10, as follows: 0 to 3, mild; 4 to 6, moderate; and 7 to 10, severe. Redness and induration at the injection site were graded based on the size of the lesion. For redness the following definitions were used: 0 to 40 mm, mild; >40 to 90 mm, moderate; and >100 mm, severe. For induration the definitions were: 0 to 20 mm, mild; >20 to 40 mm, moderate; and >50 mm, severe. Movement limitation and systemic reactions were defined as mild (noticeable but no interference with normal activity), moderate (interference with normal activity), or severe (significant limitation of daily life activities). Before the second injection, to reduce the risk of hypersensitivity to the vaccine, skin prick tests were performed using a solution of MSP3-LSP (10 µg/ml) in 0.9% NaCl (ALK/Abello, Horsholm, Denmark). A prick test read at 15 min that induced a wheal that was
3 mm in diameter was considered negative.
Assay randomization.
Since in this study an escalating dose schedule was used, volunteers
were randomized in the six treatment groups in two blocks of
18 volunteers each. The 18 volunteers in the first block were
randomized in the three treatment groups in strata 1 (10-µg
dose) and 2 (30-µg dose), and the 18 volunteers in the
second block were randomized in the three treatment groups in
strata 3 (100-µg dose) and 4 (300-µg dose). Within
each stratum, volunteers were matched for sex and age by using
a standard procedure in the programming language SAS 8.1 for
Windows by A. M. Jensen, Statens Seruminstitut, Copenhagen,
Denmark.
Immunological analysis.
At months 0, 1, 2, 4, 5, and 12, the immune responses were evaluated with whole blood samples collected with citrate as an anticoagulant (Vacutainer; BD, Basel, Switzerland); fresh peripheral blood mononuclear cells (PBMC) were separated on a density gradient, washed, and used for lymphocyte proliferation assays and cytokine production. Plasma was collected after the first centrifugation.
Antibody responses.
Anti-MSP3 antibodies in plasma samples were measured by an ELISA as described previously (35). Microtiter plates (Nunc Maxisorp, Naperville, IL) were coated with 50 µl of MSP3-LSP (or rMSP3 as indicated below) at concentrations of 1 and 7 µg/ml in phosphate-buffered saline (PBS) and blocked in PBS-5% nonfat milk. Results were expressed as the ratio of the test sample optical density (1:100 dilution) to the mean optical density plus 3 standard deviations (overall range of values, 0.251 to 0.710) for 20 individual healthy blood donor plasma samples (1:100). A ratio of >1 was considered positive. Alternatively, results were expressed as titers, which were defined as the greatest dilutions at which the sample optical density was greater than the mean optical density plus 3 standard deviations for a pool of healthy blood donor plasma.
Anti-MSP3-LSP isotypes were determined by using a previously described method (35). Results were expressed as individual ratios of postimmune optical density to preimmune plasma sample optical density.
An antibody binding competition assay was performed with plasma from individuals with the highest antibody level at month 5. Increasing concentrations of MSP3-LSP in PBS-2.5% nonfat milk were incubated for 30 min at room temperature with plasma samples at a titer corresponding to 50% of the maximal anti-MSP3-LSP ELISA response (30). LSP-bound specific anti-MSP3-LSP IgG was detected as described above.
Immunofluorescence assays and immunoblotting were performed as described previously (7, 14, 42).
T-cell proliferation assay.
Fresh PBMC were distributed in sextuplicate in 96-well flat-bottom plates (3 x 105 cells/well) (28). The PBMC were stimulated with a range of concentrations of MSP3-LSP (1.2, 6, and 30 µg/ml), with MSP3 peptides a, b, c, and d (2 and 10 µg/ml), or with medium, tetanus toxoid (10 µg/ml), or phytohemagglutinin (5 µg/ml) as controls. The median count in unstimulated cultures was 318 cpm (5th and 95th percentiles, 194 and 1,156 cpm, respectively; n = 276). Cells were harvested after 140 h, including an 18- to 20-h pulse with 1 µCi of [3H]thymidine. A response was considered positive when the stimulation index (SI) was greater than or equal to the mean SI at the baseline (preimmunization) plus 3 standard deviations.
Cytokine measurements.
Gamma interferon (IFN-
), interleukin-6 (IL-6), and IL-10 production in response to tetanus toxoid or MSP-3 LSP was measured in proliferation supernatant after 5 days, and IL-4 production was measured after 2 days. Responses to phytohemagglutinin were measured after 2 days of culture. Supernatants were evaluated by an ELISA (Elipair, Diaclone, France) by following the manufacturer's instructions. The median limits of detection of IFN-
, IL-10, IL-4, and IL-6 were 0.74, 0.45, 0.22, and 0.66 pg/ml, respectively.
Statistical evaluation.
The statistical analysis of clinical as well as immune responses performed was descriptive and per protocol. When indicated below, data were analyzed by a nonparametric Mann-Whitney test for unpaired comparisons, a nonparametric Wilcoxon test for paired comparisons, or a Kruskal-Wallis test for multiple group comparisons. Data correlation was performed using a parametric Pearson's test.

RESULTS
Study groups.
Fifty-two volunteers were screened for eligibility, and 36 of
them were enrolled and randomly assigned to the various treatment
groups (Table
1). Since two volunteers in the M30-30-30 group
developed a local reaction defined as unacceptable after the
second injection (see Materials and Methods), subsequent vaccine
doses were revised and reduced to 10 µg for groups M30-30-30
and M100-100-100 for the third and second injections, respectively
(the new groups designations were M30-30-10 and M100-10-10,
respectively). Group A30-30-30 was maintained unchanged, and
the dose for group A100-100-100 was also reduced to 10 µg
after the second injection (new group designation, A100-10-10).
Group M300-300-300 was skipped and replaced by a new group of
six volunteers who received 20 µg combined with Montanide
ISA 720 per immunization (group M20-20-20). There was a single
spontaneous dropout after the screening visit. In total, 30
volunteers received three doses of vaccine and 5 received only
two doses. The demographic characteristics of the volunteers
are shown in Table
2. There was no significant difference in
age, sex, and results for baseline clinical safety tests (data
not shown) at the time of enrollment between the various groups.
Safety and reactogenicity.
Table
3 summarizes the adverse events recorded for the six immunization
groups. No vaccine-related serious adverse events occurred during
the trial. There were no anaphylactic reactions after any of
the 100 injections. Most of the 100 injections performed did
not produce symptoms (28/100 injections) or produced transient,
mild to moderate local reactions (62/100 injections). Ten grade
3 (severe) local adverse events were observed in seven volunteers
(six volunteers who received Montanide and one volunteer who
received aluminum hydroxide); six of these reactions occurred
after the second injection, and four occurred after the third
injection. For the most part mmunization-related AEs were limited
to skin reactions at the injection site. Local reactions that
occurred within the first 48 h were recorded for 24 volunteers
after the first injection (pain in 9/35 volunteers, redness
in 7/35 volunteers, induration in 11/35 volunteers, and local
heat in 5/35) and for 27 volunteers after the second immunization
(pain in 19/35 volunteers, redness in 17/35 volunteers, induration
in 14/35 volunteers, and local heat in 12/35 volunteers). A
7- to 11-cm (range) local erythema and/or an induration that
was 4 to 11 cm in diameter was observed in five volunteers in
the Montanide groups (two volunteers in group M30-30-30, two
volunteers in group M100-100-100, and one volunteer in group
M20-20-20). The local inflammation resolved spontaneously within
48 to 72 h. According to preestablished criteria, these five
volunteers did not receive further immunizations. Finally, after
the third injection, local reactions were observed in 21 volunteers
(pain in 13/30 volunteers, redness in 17/30 volunteers, induration
in 10/30 volunteers, and local heat in 9/30 volunteers). An
unacceptable local reaction was observed within 48 h in two
volunteers in groups M10-10-10 (induration, 10 by 10 cm; erythema,
10 by 10 cm) and A30-30-30 (induration and erythema of the whole
injected arm circumference with 2- by 3-cm controlateral erythema)
and was resolved within 5 days. Moreover, in a volunteer with
a mild local reaction in the M100-10-10 group, we observed a
unilateral, nonpruriginous, painless, subcutaneous nodular induration
that reached a maximal diameter of 25 mm 1 month after the second
injection. After the third injection, similar local nodular
indurations developed in two volunteers with severe local reactions
in groups M10-10-10 and A30-30-30 and in one volunteer with
a mild local reaction in group M30-30-10. The nodules reached
maximal diameters of 25, 8, and 25 mm, respectively, 1 month
after the third injection. All indurations were still palpable
at the last follow-up visit (month 18).
Systemic reactions were limited to benign manifestations. Fatigue was reported by three volunteers (in groups M10-10-10, M20-20-20, and M100-10-10) after the second injection and by one volunteer (in group A100-10-10) after the third injection. Each period of fatigue was considered probably related to vaccination and resolved spontaneously within 24 h. Complaints of drowsiness for 3 h and complaints of palpitations for 1 h were reported about 6 h after the second injection by two volunteers (in groups A100-10-10 and M100-10-10) and were considered possibly related to the vaccine. Immediate hypersensitivity tests (skin prick tests) were negative for all patients. The results of clinical safety tests remained within normal values during the 1-year follow-up, and physical examinations at 18 months did not lead to detection of any abnormal sign or symptom.
Anti-MSP3-LSP and anti-rMSP3 210-380 antibody responses.
After the second and third injections, 63% (22/35) and 77% (23/30) of the volunteers, respectively, produced detectable antibodies against MSP3-LSP (ratio, >1) (Fig. 1). Following the third injection (month 5), independent of the dose and adjuvant used, the positive responses in the six groups varied from a ratio of 1.1 to a ratio of 4.5 (median, 2.7), and the titers ranged from 200 to 3,200 (median, 1,600). In comparison, 29 of 34 plasma samples (85%) from individuals living in areas where malaria is endemic were positive for anti-MSP3-LSP antibodies; the median ratio was 2.9 (range, 1.2 to 9.5), and the titers ranged from 400 to 50,000 (median, 1,600). The strongest and earliest antibody responses occurred in the M30-30-10 group (month 2); however, comparable between-group levels of responses were reached after the second and third immunizations (for between-group comparisons of A30-30-30, M30-30-10, and M20-20-20, P < 0.05). After the third injection, nonresponders were equally distributed in the different groups (4/18 volunteers in the Montanide groups and 3/12 volunteers in the aluminum hydroxide groups). Of the five volunteers who received only two injections (in groups M20-20-20, M30-30-10, and M100-10-10), four were still considered responders at month 5 and two were still considered responders at month 12.
Nineteen of 35 volunteers developed antibodies against rMSP3
210-380 (ratio, >1) at month 2, whereas 22 recognized MSP3-LSP
(ratio, >1) (coefficient of determination,
r2 = 0.873). Anti-rMSP3
210-380 antibody responses are shown in Table
4.
View this table:
[in this window]
[in a new window]
|
TABLE 4. Specific anti-rMSP3 210-380 antibody responses, immunofluorescence assay results, immunoblotting results, and antibody affinity results for the six immunization groups
|
Antibody binding competition assay.
The specific binding activity of the IgG induced by MSP3-LSP
was evaluated by a competition assay using plasma from 21 volunteers
with the highest antibody levels at month 5. The peptide concentrations
necessary to inhibit antibody binding by 50% varied from undetectable
competition in the presence of an excess of soluble peptides
(in two individuals in groups M100-10-10 and A30-30-30) to concentrations
as low as 36 pg/ml. Higher affinity values were observed for
the aluminum hydroxide groups (median, 169 pg/ml;
n = 8) than
for the Montanide groups (median, 49,610 pg/ml;
n = 13). The
results of a detailed affinity analysis for the immunization
groups are shown in Table
4.
Anti-MSP3-LSP isotype antibody response.
The anti-MSP3-LSP isotype response at months 2 and 5 was predominantly an IgG1 subclass response, and it increased significantly up to the third injection (month 2 versus month 5, P < 0.001; all groups confounded) (Fig. 2). Other IgG subclass responses were lower and equally represented for the different groups (IgG2, IgG3, IgG4). As expected, IgM anti-MSP3-LSP levels tended to decrease over time (P = 0.0152). We also observed a trend toward a decrease in IgG4 in the Montanide groups after the third injection (P = 0.03), which resulted in an increase in the ratio of cytophilic to noncytophilic antibodies [(IgG1, IgG3)/(IgG2, IgG4, IgM)].
Recognition of the native MSP3 protein.
Nineteen of 30 individuals had antibodies that were reactive
to native MSP3 on
P. falciparum mature schizonts, as determined
by immunofluorescence, at moderate titers ranging from 1/50
to 1/400 (11/18 volunteers in the Montanide groups and 8/12
volunteers in the aluminum hydroxide groups) (Table
4). We also
examined the antibody reactivities of volunteers to the native
parasite MSP3 protein in extracts from
P. falciparum mature
schizonts by immunoblotting (Fig.
3 and Table
4). Eighteen of
30 volunteers who completed the immunization schedule had antibody
activity that was specific for the parasite 48-kDa protein after
the third injection. Overall, 22 volunteers were positive after
month 5 or month 12. The distributions of positive samples were
equivalent in the different immunization groups, and noticeably,
aluminum hydroxide was as effective as Montanide at eliciting
parasite-reactive antibodies (13/18 volunteers in the Montanide
groups and 9/12 volunteers in the aluminum hydroxide groups).
There was a good correlation with the anti-MSP3-LSP-specific
antibody response as determined by ELISA, since all but one
volunteer with a ratio of >1.6 were positive as determined
by immunoblotting.
T-cell proliferative response to MSP3-LSP.
Generally, postimmunization T-cell proliferative responses were
observed for all but one volunteer, and their intensities (median
SI, 27; 5th percentile to 95th percentile, 1.2 to 143) were
comparable to those of tetanus toxoid-stimulated cultures (median
SI, 62; 5th percentile to 95th percentile, 7 to 170) (Fig.
4).
The kinetics of T-cell responses to MSP3-LSP did not differ
significantly in the aluminum hydroxide and Montanide groups
(
P < 0.05, as determined by the Kruskal-Wallis test), which
displayed vigorous proliferation in most cases after priming.
Immediately after the first injection, 25 (71%) volunteers developed
a rapid response, which remained detectable up to month 12.
Responders were equally distributed in the different groups,
with minor differences. In group M10-10-10, there were only
four responders after the second injection, and two volunteers
developed a late response after the third injection (SI, 20
and 134). In group M20-20-20, a unique volunteer never developed
a proliferative response. Two volunteers (groups M30-30-10 and
A30-30-30) had a positive response after the first injection
(SI, 14 and 18) that declined to the baseline 1 month later.
All five volunteers who did not receive the third injection
had a positive proliferative response 4 months after the second
dose (SI, 6 to 98). In summary, at month 5, 26/30 volunteers
developed a proliferative response. At month 12, 22/30 volunteers
who completed the course of immunization and 4/5 of the volunteers
excluded from the third injection still had a positive proliferative
response.
Proliferative response to MSP3 overlapping peptides.
To evaluate the epitope-specific responses, overlapping peptides
designated MSP3-a, -b, -c, and -d covering amino acids 194 to
276 of MSP3-LSP were used to stimulate T cells at months 2 and
5. The T-cell responses at month 2 were high but generally lower
than the responses to the full MSP3-LSP measured in parallel
(
P < 0.001) (Fig.
5). They were dominated by responses to
fragment MSP3-a both in terms of intensity (
P < 0.001) and
in terms of the percentage of responders. Aluminum hydroxide
clearly induced higher responses to fragments MSP3-a and -b
than Montanide induced (
P = 0.01 and
P = 0.002, respectively).
Finally, the responses to peptide MSP3-d were minimal. Data
obtained at month 5 were essentially similar (data not shown).
Cytokine production.
Stimulation with MSP3-LSP triggered mostly IFN-

secretion from
PBMC of volunteers (median concentration, 1,080 pg/ml) (Fig.
6). Interestingly, there was parallelism between T-cell proliferative
responses and IFN-

production, since IFN-

was detected in 30
volunteers who were also responders in the T-cell proliferation
assay (i.e., in all except four volunteers). Although phytohemagglutinin
induced IL-4, IL-10, and IL-6 secretion, none of the cytokines
was induced by stimulation either with MSP3-LSP or with tetanus
toxoid (data not shown).

DISCUSSION
The phase I vaccine trial described here demonstrated that immunization
with MSP3-LSP was able to induce vigorous specific T-cell proliferation,
IFN-

secretion, and a predominantly cytophilic IgG1 subclass
humoral response, when it was administered to healthy volunteers
and with both adjuvants studied. However, the Montanide formulation
led to the withdrawal of an unacceptably high number of volunteers
with severe local reactions, whereas the aluminum hydroxide
formulation was generally well tolerated. The largely cytophilic
IgG1 anti-MSP-3-specific profile of the humoral response may
confer to the vaccine potential monocyte-mediated protective
activity (
1,
32,
40). This should be addressed in endemic area
trials or with individuals exposed to malaria challenges.
In agreement with our previous observations with similar synthetic vaccine formulations derived from other antigens (20, 28, 45), MSP3-LSP was well tolerated in a majority of individuals with both formulations, and we did not observe any serious adverse events; we observed only five mild probably or possibly vaccine-related systemic reactions. Protocol-defined unacceptable reactogenicity was limited to delayed-type local inflammatory reactions within 48 h following the immunization which were more than 10 cm in diameter and/or to
5-cm indurations in seven volunteers. These reactions were observed in all cases except one in volunteers who received Montanide (six of seven volunteers) and led to withdrawal of five volunteers from the third injection and to marked revision of the injection doses in four of the six groups. This was justified by our policy to give priority to safety-guided decisions during the trial. Indeed, Montanide ISA 720, which is generally well tolerated when it is injected alone (24), may lead to substantial or even severe adverse events when it is combined with antigens. This may depend on the nature of the antigen tested, as shown with several P. falciparum recombinant proteins (38) or human immunodeficiency virus-derived proteins (9, 43). In all cases of withdrawal, the resolution was complete without evidence of skin ulceration, scarring, or arm function limitation, except for nodular indurations that were still palpable at month 18 in two cases for volunteers in the M10-10-10 and A30-30-30 groups. In the later trials, reactions were observed usually at high antigen doses and following the second or third injection. A review of nine previously published and unpublished vaccine trials that included 296 individuals who received vaccines with the Montanide ISA 720 adjuvant by the intramuscular route showed that there were mild to moderate local reactions in 54% of the volunteers and severe local reactions (pain, granuloma, and sterile abscesses) in 4% of the volunteers (16). There was a clear relationship between the antigen dose and the prevalence and intensity of severe, inflammatory, delayed-type local reactions (16). On the other hand, aluminum hydroxide has a well-established safety record with a low incidence of adverse events, which are limited generally to minor local reactions (4). Administered here by the subcutaneous route, MSP3-LSP with the aluminum hydroxide adjuvant induced only occasional and mild local reactions and was overall better tolerated than the MSP3-LSP associated with Montanide ISA 720.
Taken together, compared to other recent antimalaria vaccine trials in which severe hypersensitivity reactions (22, 23, 31) or marked systemic reactions (41) were reported, the reactions observed in our study were mainly local and related to the adjuvant used. In association with aluminum hydroxide, MSP3-LSP vaccine-related AEs were mild and acceptable (except in one case), in contrast to the AEs observed with the vaccine containing the Montanide adjuvant (six unacceptable local reactions). In recent trials, DNA-based vaccines induced rare local side effects, but at the cost of low immunogenicity since the humoral response after immunization was undetectable (18, 25), except after a boost with a recombinant protein vaccine (17).
A specific humoral response developed in the majority of volunteers with similar kinetics and intensity in both groups. The anti-MSP3-LSP titers compared favorably with those developed by individuals exposed to malaria in areas where malaria is endemic. The anti-MSP3-LSP response developed equally in the various groups, independent of the adjuvant used. Interestingly, the affinity of the anti-MSP3-LSP antibody response was greater in volunteers who received aluminum hydroxide than in volunteers who received Montanide. Most importantly, both adjuvants led to generation of cytophilic antibodies (mainly IgG1) (i.e., isotypes capable of supporting in vitro and in vivo antibody-dependent, monocyte-mediated parasite growth inhibition). Indeed, IgG1 and IgG3 anti-plasmodium antibodies, but not IgG2, IgG4, and IgM anti-plasmodium antibodies (1, 32) or anti-MSP3 antibodies (40), have been associated with protection in humans, as well as in primates, and to be the key players of ADCI (6, 8, 15, 33-35). We also showed that these antibodies were also able to bind a nonsynthetic recombinant MSP3 molecule (rMSP3 210-380). This fulfilled the primary end point of the trial. Moreover, native P. falciparum MSP3 protein was detectable by immunofluorescence and by immunoblotting in a substantial proportion of volunteers (19 of 30 and 22 of 30 volunteers, respectively). This is in accordance with the results of in vitro ADCI assays and in vivo SCID mouse experiments that demonstrated that vaccine-induced anti-MSP3 antibodies from sera of volunteers strongly inhibited P. falciparum development (15a).
MSP3-LSP proved able to trigger in humans a very high prevalence of strong T-cell responses, as shown by high proliferation indices and IFN-
production in all but one volunteer. The latter point is important, since IFN-
plays a key role in anti-blood-stage defense and, more specifically, in inducing cytophilic IgG and in enhancing the ADCI capability of monocytes (8). In addition, the T-lymphocyte memory was extremely long lasting, as shown by the high prevalence at 12 months, particularly in the aluminum hydroxide group, in which the stimulation indices remained almost unchanged. This high T-cell immunogenicity is likely related to four T-cell epitopes previously identified in humans exposed to malaria (from Senegal). In the field, peptides a, b, and c induced proliferation and IFN-
secretion (peptide d is currently under study), with the highest prevalence for peptide b (39), in contrast to peptide a in volunteers. However, it is impossible to determine if this observation is related to human genetic differences or to differences in antigen presentation by the parasite or by the vaccine. The individuals who lost the T-cell response over time were volunteers who did not receive the third injection because of unacceptable local reactions. Globally, this indicates that both the number of injections and the dose of MSP3-LSP were important in maintaining significant proliferative and antibody responses. In agreement with the strong production of IFN-
, the T-cell response to MSP3-LSP promoted an antibody response that was indeed largely TH1 in character (IgG1 and IgG3).
It is important to stress that the immunogenicity of MSP3-LSP formulations with aluminum hydroxide in human volunteers was not predicted by preclinical data in animal models with the same adjuvant (Druilhe, unpublished data). Aluminum hydroxide, which did not elicit detectable responses in three strains of mice, as it did in primates, appeared to be at least as efficient as Montanide in humans. The stronger immunogenicity (antibody response, T-cell proliferation, IFN-
production) in humans may be related to our strategy of selecting the immunodominant epitopes in exposed volunteers.
Although the number of volunteers in each immunization group did not allow statistical comparison of aluminum hydroxide and Montanide, the results obtained with MSP3 with aluminum hydroxide as the adjuvant (in particular with 30 µg MSP30-LSP) in terms of immunogenicity and tolerance indicate that this adjuvant is the most valuable adjuvant for future studies. The safety record of aluminum hydroxide strongly supports this option (4, 12). A phase Ib field trial with exposed individuals and MSP3-LSP-aluminum hydroxide is currently under way.

ACKNOWLEDGMENTS
This work was supported by a grant from European Malaria Vaccine
Initiative 0003/2001CLIN.
We thank Ahmed Bouzidi for his critical contributions to GMP production; the study volunteers for their participation in the study; Géraldine Frank, Valentin Meraldi, Katrin Peter, and Alexandre Schmidt, Institute of Biochemistry, Epalinges, Switzerland, and Estelle Monnier, CHUV, Lausanne, Switzerland, for their technical assistance; A. M. Jensen, Statens Seruminstitut, Copenhagen, Denmark, for his help with assay randomization; and Stéphane Ascarateil and Jérôme Aucouturier, SEPPIC, Paris, France, for providing Montanide ISA 720.

FOOTNOTES
* Corresponding author. Mailing address: Division of Immunology and Allergy, Centre Hospitalier Universitaire Vaudois, BH-19, Rue du Bugnon, 1011 Lausanne, Switzerland. Phone: 41 21 314 0790. Fax: 41 21 314 0791. E-mail:
francois.spertini{at}chuv.ch.

Editor: J. F. Urban, Jr.

REFERENCES
1 - Aribot, G., C. Rogier, J. L. Sarthou, J. F. Trape, A. T. Balde, P. Druilhe, and C. Roussilhon. 1996. Pattern of immunoglobulin isotype response to Plasmodium falciparum blood-stage antigens in individuals living in a holoendemic area of Senegal (Dielmo, West Africa). Am. J. Trop. Med. Hyg. 54:449-457.
2 - Astori, M., C. von Garnier, A. Kettner, N. Dufour, G. Corradin, and F. Spertini. 2000. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J. mice. J. Immunol. 165:3497-3505.[Abstract/Free Full Text]
3 - Badell, E., C. Oeuvray, A. Moreno, S. Soe, N. van Rooijen, A. Bouzidi, and P. Druilhe. 2000. Human malaria in immunocompromised mice: an in vivo model to study defense mechanisms against Plasmodium falciparum. J. Exp. Med. 192:1653-1660.[Abstract/Free Full Text]
4 - Baylor, N. W., W. Egan, and P. Richman. 2002. Aluminum salts in vaccinesUS perspective. Vaccine 20:S18-S23.
5 - Blum-Tirouvanziam, U., C. Beghdadi-Rais, M. A. Roggero, D. Valmori, S. Bertholet, C. Bron, N. Fasel, and G. Corradin. 1994. Elicitation of specific cytotoxic T cells by immunization with malaria soluble synthetic polypeptides. J. Immunol. 153:4134-4141.[Abstract]
6 - Bouharoun-Tayoun, H., P. Attanath, A. Sabchareon, T. Chongsuphajaisiddhi, and P. Druilhe. 1990. Antibodies that protect humans against Plasmodium falciparum blood stages do not on their own inhibit parasite growth and invasion in vitro, but act in cooperation with monocytes. J. Exp. Med. 172:1633-1641.[Abstract/Free Full Text]
7 - Bouharoun-Tayoun, H., and P. Druilhe. 1992. Plasmodium falciparum malaria: evidence for an isotype imbalance which may be responsible for delayed acquisition of protective immunity. Infect. Immun. 60:1473-1481.[Abstract/Free Full Text]
8 - Bouharoun-Tayoun, H., C. Oeuvray, F. Lunel, and P. Druilhe. 1995. Mechanisms underlying the monocyte-mediated antibody-dependent killing of Plasmodium falciparum asexual blood stages. J. Exp. Med. 182:409-418.[Abstract/Free Full Text]
9 - Cano, C. A. 1999. The multi-epitope polypeptide approach in HIV-1 vaccine development. Genet. Anal. 15:149-153.[Medline]
10 - Carvalho, L. J., S. G. Oliveira, M. Theisen, F. A. Alves, M. C. Andrade, G. M. Zanini, M. C. Brigido, C. Oeuvray, M. M. Povoa, J. A. Muniz, P. Druilhe, and C. T. Daniel-Ribeiro. 2004. Immunization of Saimiri sciureus monkeys with Plasmodium falciparum merozoite surface protein-3 and glutamate-rich protein suggests that protection is related to antibody levels. Scand. J. Immunol. 59:363-372.[CrossRef][Medline]
11 - Carvalho, L. J. M., F. A. Alves, C. Bianco, Jr., S. G. Oliveira, G. M. Zanini, S. Soe, P. Druilhe, M. Theisen, J. A. P. C. Muniz, and C. T. Daniel-Ribeiro. 2005. Immunization of Saimiri sciureus monkeys with a recombinant hybrid protein derived from the Plasmodium falciparum antigen glutamate-rich protein and merozoite surface protein 3 can induce partial protection with Freund and Montanide ISA720 adjuvants. Clin. Diagn. Lab. Immunol. 12:242-248.[Abstract/Free Full Text]
12 - Clements, C. J., and E. Griffiths. 2002. The global impact of vaccines containing aluminium adjuvants. Vaccine 20:S24-S33.
13 - Demotz, S., C. Moulon, M. A. Roggero, N. Fasel, and S. Masina. 2001. Native-like, long synthetic peptides as components of sub-unit vaccines: practical and theoretical considerations for their use in humans. Mol. Immunol. 38:415-422.[CrossRef][Medline]
14 - Druilhe, P., and S. Khusmith. 1987. Epidemiological correlation between levels of antibodies promoting merozoite phagocytosis of Plasmodium falciparum and malaria-immune status. Infect. Immun. 55:888-891.[Abstract/Free Full Text]
15 - Druilhe, P., and J. L. Perignon. 1994. Mechanisms of defense against P. falciparum asexual blood stages in humans. Immunol. Lett. 41:115-120.[CrossRef][Medline]
15 - Druilhe, P., F. Spertini, S. Soe, G. Corradin, P. Meijia, S. Sing, R. Audran, A. Bouzidi, C. Oeuvray, and C. Roussilhon. A malaria vaccine that elicits in humans antibodies able to kill Plasmodium falciparum. PLOS, J., in press.
16 - Dubovsky, F., and E. Tierney. 2003. Review of local reactions with Montanide ISA720. Vaccine 21:3503-3524.[CrossRef][Medline]
17 - Epstein, J. E., Y. Charoenvit, K. E. Kester, R. Wang, R. Newcomer, S. Fitzpatrick, T. L. Richie, N. Tornieporth, D. G. Heppner, and C. Ockenhouse. 2004. Safety, tolerability, and antibody responses in humans after sequential immunization with a PfCSP DNA vaccine followed by the recombinant protein vaccine RTS,S/AS02A. Vaccine 22:1592-1603.[CrossRef][Medline]
18 - Epstein, J. E., E. J. Gorak, Y. Charoenvit, R. Wang, N. Freydberg, O. Osinowo, T. L. Richie, E. L. Stoltz, F. Trespalacios, J. Nerges, J. Ng, V. Fallarme-Majam, E. Abot, L. Goh, S. Parker, S. Kumar, R. C. Hedstrom, J. Norman, R. Stout, and S. L. Hoffman. 2002. Safety, tolerability, and lack of antibody responses after administration of a PfCSP DNA malaria vaccine via needle or needle-free jet injection, and comparison of intramuscular and combination intramuscular/intradermal routes. Hum. Gene Ther. 13:1551-1560.[CrossRef][Medline]
19 - European Medicines Agency. 1995. Guidelines for good clinical practice. ICH topic E6:CPMP/ICH/135/95. European Medicines Agency, London, United Kingdom.
20 - Fellrath, J.-M., A. Kettner, N. Dufour, C. Frigerio, D. Schneeberger, A. Leimgruber, G. Corradin, and F. Spertini. 2003. Allergen specific T cell tolerance induction with allergen-derived long peptides: results of a phase I safety and immunogenicity trial. J Allergy Clin. Immunol. 111:854-861.[CrossRef][Medline]
21 - Hisaeda, H., A. Saul, J. J. Reece, M. C. Kennedy, C. A. Long, L. H. Miller, and A. W. Stowers. 2002. Merozoite surface protein 3 and protection against malaria in Aotus nancymai monkeys. J. Infect. Dis. 185:657-664.[CrossRef][Medline]
22 - Kashala, O., R. Amador, M. V. Valero, A. Moreno, A. Barbosa, B. Nickel, C. A. Daubenberger, F. Guzman, G. Pluschke, and M. E. Patarroyo. 2002. Safety, tolerability and immunogenicity of new formulations of the Plasmodium falciparum malaria peptide vaccine SPf66 combined with the immunological adjuvant QS-21. Vaccine 20:2263-2277.[CrossRef][Medline]
23 - Keitel, W. A., K. E. Kester, R. L. Atmar, A. C. White, N. H. Bond, C. A. Holland, U. Krzych, D. R. Palmer, A. Egan, C. Diggs, W. R. Ballou, B. F. Hall, and D. Kaslow. 1999. Phase I trial of two recombinant vaccines containing the 19kd carboxy terminal fragment of Plasmodium falciparum merozoite surface protein 1 (msp-1(19)) and T helper epitopes of tetanus toxoid. Vaccine 18:531-539.[CrossRef][Medline]
24 - Lawrence, G. W., A. Saul, A. J. Giddy, R. Kemp, and D. Pye. 1997. Phase I trial in humans of an oil-based adjuvant, SEPPIC MONTANIDE ISA 720. Vaccine 15:176-178.[CrossRef][Medline]
25 - Le, T. P., K. M. Coonan, R. C. Hedstrom, Y. Charoenvit, M. Sedegah, J. E. Epstein, S. Kumar, R. Wang, D. L. Doolan, J. D. Maguire, S. E. Parker, P. Hobart, J. Norman, and S. L. Hoffman. 2000. Safety, tolerability and humoral immune responses after intramuscular administration of a malaria DNA vaccine to healthy adult volunteers. Vaccine 18:1893-1901.[CrossRef][Medline]
26 - Lopez, J. A., J. M. Gonzalez, A. Kettner, M. Arevalo-Herrera, S. Herrera, G. Corradin, and M. A. Roggero. 1997. Synthetic polypeptides corresponding to the non-repeat regions from the circumsporozoite protein of Plasmodium falciparum: recognition by human T-cells and immunogenicity in owl monkeys. Ann. Trop. Med. Parasitol. 91:253-265.[CrossRef][Medline]
27 - Lopez, J. A., M. A. Roggero, O. Duombo, J. M. Gonzalez, R. Tolle, O. Koita, M. Arevalo-Herrera, S. Herrera, and G. Corradin. 1996. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoite protein by sera from human donors. Am. J. Trop. Med. Hyg. 55:424-429.
28 - Lopez, J. A., C. Weilenman, R. Audran, M. A. Roggero, A. Bonelo, J. M. Tiercy, F. Spertini, and G. Corradin. 2001. A synthetic malaria vaccine elicits a potent CD8+ and CD4+ T lymphocyte immune response in humans. Implications for vaccination strategies. Eur. J. Immunol. 31:1989-1998.[CrossRef][Medline]
29 - McColl, D. J., and R. F. Anders. 1997. Conservation of structural motifs and antigenic diversity in the Plasmodium falciparum merozoite surface protein-3 (MSP-3). Mol. Biochem. Parasitol. 90:21-31.[CrossRef][Medline]
30 - Men, Y., C. Thomasin, H. P. Merkle, B. Gander, and G. Corradin. 1995. A single administration of tetanus toxoid in biodegradable microspheres elicits T cell and antibody responses similar or superior to those obtained with aluminum hydroxide. Vaccine 13:683-689.[CrossRef][Medline]
31 - Nardin, E. H., G. A. Oliveira, J. M. Calvo-Calle, Z. R. Castro, R. S. Nussenzweig, B. Schmeckpeper, B. F. Hall, C. Diggs, S. Bodison, and R. Edelman. 2000. Synthetic malaria peptide vaccine elicits high levels of antibodies in vaccinees of defined HLA genotypes. J. Infect. Dis. 182:1486-1496.[CrossRef][Medline]
32 - Ndungu, F. M., P. C. Bull, A. Ross, B. S. Lowe, E. Kabiru, and K. Marsh. 2002. Naturally acquired immunoglobulin (Ig)G subclass antibodies to crude asexual Plasmodium falciparum lysates: evidence for association with protection for IgG1 and disease for IgG2. Parasite Immunol. 24:77-82.[CrossRef][Medline]
33 - Oeuvray, C., H. Bouharoun-Tayoun, H. Gras-Masse, E. Bottius, T. Kaidoh, M. Aikawa, M. C. Filgueira, A. Tartar, and P. Druilhe. 1994. Merozoite surface protein-3: a malaria protein inducing antibodies that promote Plasmodium falciparum killing by cooperation with blood monocytes. Blood 84:1594-1602.[Abstract/Free Full Text]
34 - Oeuvray, C., H. Bouharoun-Tayoun, H. Grass-Masse, J. P. Lepers, L. Ralamboranto, A. Tartar, and P. Druilhe. 1994. A novel merozoite surface antigen of Plasmodium falciparum (MSP-3) identified by cellular-antibody cooperative mechanism antigenicity and biological activity of antibodies. Mem. Inst. Oswaldo Cruz 89:77-80.
35 - Oeuvray, C., M. Theisen, C. Rogier, J. F. Trape, S. Jepsen, and P. Druilhe. 2000. Cytophilic immunoglobulin responses to Plasmodium falciparum glutamate-rich protein are correlated with protection against clinical malaria in Dielmo, Senegal. Infect. Immun. 68:2617-2620.[Abstract/Free Full Text]
36 - Roggero, M. A., C. Weilenmann, A. Bonelo, R. Audran, J. Renggli, F. Spertini, G. Corradin, and J. A. Lopez. 1999. Plasmodium falciparum CS C-terminal fragment: preclinical evaluation and phase I clinical studies. Parassitologia 41:421-424.[Medline]
37 - Sabchareon, A., T. Burnouf, D. Ouattara, P. Attanath, H. Bouharoun-Tayoun, P. Chantavanich, C. Foucault, T. Chongsuphajaisiddhi, and P. Druilhe. 1991. Parasitologic and clinical human response to immunoglobulin administration in falciparum malaria. Am. J. Trop. Med. Hyg. 45:297-308.
38 - Saul, A., G. Lawrence, A. Smillie, C. M. Rzepczyk, C. Reed, D. Taylor, K. Anderson, A. Stowers, R. Kemp, A. Allworth, R. F. Anders, G. V. Brown, D. Pye, P. Schoofs, D. O. Irving, S. L. Dyer, G. C. Woodrow, W. R. Briggs, R. Reber, and D. Sturchler. 1999. Human phase I vaccine trials of 3 recombinant asexual stage malaria antigens with Montanide ISA720 adjuvant. Vaccine 17:3145-3159.[CrossRef][Medline]
39 - Singh, S., S. Soe, J.-P. Mejia, C. Roussilhon, M. Theisen, G. Corradin, and P. Druilhe. 2004. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design. J. Infect. Dis. 190:1010-1018.[CrossRef][Medline]
40 - Soe, S., M. Theisen, C. Roussilhon, K.-S. Aye, and P. Druilhe. 2004. Association between protection against clinical malaria and antibodies to merozoite surface antigens in an area of hyperendemicity in Myanmar: complementarity between responses to merozoite surface protein 3 and the 220-kilodalton glutamate-rich protein. Infect. Immun. 72:247-252.[Abstract/Free Full Text]
41 - Stoute, J. A., M. Slaoui, D. G. Heppner, P. Momin, K. E. Kester, P. Desmons, B. T. Wellde, N. Garcon, U. Krzych, and M. Marchand. 1997. A preliminary evaluation of a recombinant circumsporozoite protein vaccine against Plasmodium falciparum malaria. RTS,S Malaria Vaccine Evaluation Group. N. Engl. J. Med. 336:86-91.[Abstract/Free Full Text]
42 - Theisen, M., S. Soe, C. Oeuvray, A. W. Thomas, J. Vuust, S. Danielsen, S. Jepsen, and P. Druilhe. 1998. The glutamate-rich protein (GLURP) of Plasmodium falciparum is a target for antibody-dependent monocyte-mediated inhibition of parasite growth in vitro. Infect. Immun. 66:11-17.[Abstract/Free Full Text]
43 - Toledo, H., A. Baly, O. Castro, S. Resik, J. Laferte, F. Rolo, L. Navea, L. Lobaina, O. Cruz, J. Miguez, T. Serrano, B. Sierra, L. Perez, M. E. Ricardo, M. Dubed, A. L. Lubian, M. Blanco, J. C. Millan, A. Ortega, E. Iglesias, E. Penton, Z. Martin, J. Perez, M. Diaz, and C. A. Duarte. 2001. A phase I clinical trial of a multi-epitope polypeptide TAB9 combined with Montanide ISA 720 adjuvant in non-HIV-1 infected human volunteers. Vaccine 19:4328-4336.[CrossRef][Medline]
44 - von Garnier, C., M. Astori, A. Kettner, N. Dufour, C. Heusser, G. Corradin, and F. Spertini. 2000. Allergen-derived long peptide immunotherapy down-regulates specific IgE response and protects from anaphylaxis. Eur. J. Immunol. 30:1638-1645.[CrossRef][Medline]
45 - Weilenman, C., R. Audran, A. Bonelo, J. A. Lopez, G. Corradin, and F. Spertini. 2000. OM-174 a novel adjuvant; preliminary results of a human malaria vaccination. Allergologie 23:3. (Abstract.)
Infection and Immunity, December 2005, p. 8017-8026, Vol. 73, No. 12
0019-9567/05/$08.00+0 doi:10.1128/IAI.73.12.8017-8026.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
This article has been cited by other articles:
-
Daher, L.-J., Demanga, C. G., Prieur, E., Perignon, J.-L., Bouharoun-Tayoun, H., Druilhe, P.
(2010). Toward the Rational Design of a Malaria Vaccine Construct Using the MSP3 Family as an Example: Contribution of Immunogenicity Studies in Models. Infect. Immun.
78: 477-485
[Abstract]
[Full Text]
-
Demanga, C. G., Daher, L.-J., Prieur, E., Blanc, C., Perignon, J.-L., Bouharoun-Tayoun, H., Druilhe, P.
(2010). Toward the Rational Design of a Malaria Vaccine Construct Using the MSP3 Family as an Example: Contribution of Antigenicity Studies in Humans. Infect. Immun.
78: 486-494
[Abstract]
[Full Text]
-
Othoro, C., Johnston, D., Lee, R., Soverow, J., Bystryn, J.-C., Nardin, E.
(2009). Enhanced Immunogenicity of Plasmodium falciparum Peptide Vaccines Using a Topical Adjuvant Containing a Potent Synthetic Toll-Like Receptor 7 Agonist, Imiquimod. Infect. Immun.
77: 739-748
[Abstract]
[Full Text]
-
Nebie, I., Diarra, A., Ouedraogo, A., Soulama, I., Bougouma, E. C., Tiono, A. B., Konate, A. T., Chilengi, R., Theisen, M., Dodoo, D., Remarque, E., Bosomprah, S., Milligan, P., Sirima, S. B.
(2008). Humoral Responses to Plasmodium falciparum Blood-Stage Antigens and Association with Incidence of Clinical Malaria in Children Living in an Area of Seasonal Malaria Transmission in Burkina Faso, West Africa. Infect. Immun.
76: 759-766
[Abstract]
[Full Text]
-
Jafarshad, A., Dziegiel, M. H., Lundquist, R., Nielsen, L. K., Singh, S., Druilhe, P. L.
(2007). A Novel Antibody-Dependent Cellular Cytotoxicity Mechanism Involved in Defense against Malaria Requires Costimulation of Monocytes Fc{gamma}RII and Fc{gamma}RIII. J. Immunol.
178: 3099-3106
[Abstract]
[Full Text]
-
Calvo-Calle, J. M., Oliveira, G. A., Watta, C. O., Soverow, J., Parra-Lopez, C., Nardin, E. H.
(2006). A Linear Peptide Containing Minimal T- and B-Cell Epitopes of Plasmodium falciparum Circumsporozoite Protein Elicits Protection against Transgenic Sporozoite Challenge. Infect. Immun.
74: 6929-6939
[Abstract]
[Full Text]
-
Lundquist, R., Nielsen, L. K., Jafarshad, A., SoeSoe, D., Christensen, L. H., Druilhe, P., Dziegiel, M. H.
(2006). Human Recombinant Antibodies against Plasmodium falciparum Merozoite Surface Protein 3 Cloned from Peripheral Blood Leukocytes of Individuals with Immunity to Malaria Demonstrate Antiparasitic Properties. Infect. Immun.
74: 3222-3231
[Abstract]
[Full Text]