Previous Article | Next Article ![]()
Infection and Immunity, March 2005, p. 1561-1567, Vol. 73, No. 3
0019-9567/05/$08.00+0 doi:10.1128/IAI.73.3.1561-1567.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
Department of Medical Microbiology and Immunology, Texas A & M University System Health Science Center, College Station, Texas,1 Department of Veterinary Microbiology, Faculty of Agriculture, Gifu University, Gifu, Gifu, Japan2
Received 6 August 2004/ Returned for modification 30 August 2004/ Accepted 27 September 2004
|
|
|---|
28-kDa mature protein with a typical signal sequence. The adaA (acute disease antigen A) gene was detected in acute group C. burnetii isolates but not identified in chronic group isolates by PCR and Southern blotting. A typical signal peptide was predicted in adaA, and specific antibody to adaA reacted with the purified membrane fraction of acute group isolates by Western blotting, suggesting that adaA is exposed on the outer surface of C. burnetii. adaA was overexpressed in pET23a as a fusion protein in Escherichia coli to develop anti-recombinant adaA (anti-radaA) specific antibody, which recognized a
28-kDa band in acute group isolates but not in chronic group isolates. In addition, immunoblotting indicates that radaA reacted with sera derived from animals infected with acute group isolates but did not react with sera from animals infected with chronic group isolates. These results support the idea that an adaA gene-targeted PCR assay and an radaA antigen-based serodiagnostic test may be useful for differential diagnosis of acute and chronic Q fever. |
|
|---|
C. burnetii has been isolated from various sources including milk, ticks, and humans with acute and chronic Q fever worldwide (2, 7, 8, 10). Previous studies have demonstrated that C. burnetii isolates originating from milk, ticks, and humans with acute Q fever differ in plasmid type (22), lipopolysaccharide profiles (3), and chromosomal DNA restriction endonuclease fragment patterns (5) from many isolates originating from chronic Q fever. The differences at the phenotypic and molecular levels between acute and chronic disease-associated isolates suggested that there may be a virulence potential characteristic of each group of isolates. Samuel et al. first reported that C. burnetii isolates associated with acute Q fever contained the QpH1 plasmid, while isolates associated with chronic Q fever possessed the QpRS plasmid or the plasmid sequences were integrated into the chromosome (22, 23). More recent studies of several C. burnetii isolates from Europe detected either the QpH1 plasmid-specific sequences (25, 26) or plasmid type QpDV (27) in both acute and chronic disease-associated isolates, suggesting that there was no specific gene(s) on plasmids responsible for a specific virulence phenotype. These data supported the notion that chronic disease could result from isolates associated with acute disease and might result from unique patient factors associated with immune status (25-27). However, no chronic disease-associated organisms have been isolated from acute Q fever patients. Therefore, it is quite possible that there are bacterial genetic factors responsible for acute disease. This hypothesis was supported in a study by Moos and Hackstadt (17) comparing virulence of a prototype isolate from each group in guinea pigs. The acute disease group prototype isolate (Nine Mile phase I RSA493) caused infection and fever when delivered intraperitoneally with less than 10 organisms, while the chronic disease group prototype isolate (Priscilla Q177) required at least 105 organisms to cause fever.
Our previous study identified a 28-kDa protein (P28) that was immunodominant in isolates originating from milk, ticks, and humans with acute Q fever but not immunogenic in isolates originating from chronic Q fever (6). This finding suggested that adaA could be associated with a pathogenic factor of acute Q fever. adaA may also have value as a marker to distinguish isolate groups. In order to clone and characterize the adaA-encoding gene, the N-terminal amino acid sequence of the protein was determined by protein sequencing. A 59-bp gene fragment was amplified from Nine Mile phase I DNA by PCR with one primer pair designed based on the N-terminal amino acid sequence and was used as a probe to screen a genomic library by Southern hybridization. The gene encoding P28 was cloned and sequenced. Outer membrane localization and antigenicity of adaA indicated that adaA may be a virulence factor related to acute Q fever, and the adaA gene may be a useful genetic marker for differentiation of isolates of C. burnetii.
|
|
|---|
|
View this table: [in a new window] |
TABLE 1. Original source, pathogenic characteristics, genetic group, and plasmid type of C. burnetii strains
|
Analysis of the N-terminal amino acid sequences of adaA. The OMPs of C. burnetii Nine Mile were separated by reversed discontinuous sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and electrophoretically transferred to a polyvinylidene difluoride membrane as described elsewhere (19). The presence of adaA in the purified membrane fraction of C. burnetii Nine Mile was confirmed by immunoblotting as described previously (6). The portion of the polyvinylidene difluoride membrane containing adaA was excised and analyzed with the HP G1005A protein sequencing system (Takara Shuzo Co., Kyoto, Japan).
Preparation of DNA probe specific to the P28-encoding gene. The N-terminal amino acid sequence of adaA was determined as ENRPILNTINYQQQVEKWVTTDSADVMVSVN. Based on the N-terminal amino acid sequence, a pair of primers, P28a (5'-ATHAAYTAYCARCARCARGT-3') and P28b (5'-AGCATNACRTCNGC-3'), were designed and used to amplify a 59-bp fragment of the putative adaA gene. The expected 59-bp product was amplified from C. burnetii Nine Mile DNA by PCR with these primers. The nucleotide sequence of the 59-bp fragment was determined by the dideoxy nucleotide chain-termination method as described previously (29). Sequence analysis of the 59-bp fragment indicates that the deduced amino acid sequence is identical to the chemically determined N-terminal amino acid sequence of P28, suggesting that the 59-bp fragment is specific DNA of the adaA gene. Based on the determined nucleotide sequence, specific primers P28a1 (5'-ATTAATTATCAACAGCAGGTTG-3') and P28b1 (5'-AGCATTACATCGGCAGAATCC-3') were designed and used to amplify the 59-bp specific fragment of the adaA gene from C. burnetii Nine Mile DNA. The amplified 59-bp fragment was labeled by the random primer extension method with the digoxigenin DNA labeling kit (Roche Diagnostics K. K., Tokyo, Japan) and used as a DNA probe to screen the genomic DNA library of C. burnetii by Southern hybridization.
Construction and screening of genomic DNA library. A lambda ZAP II genomic DNA library was constructed as described by Macellaro et al. (9) and screened by Southern hybridization with the adaA gene-specific probe. Briefly, the genomic library was plated on E. coli XL-Blue MRF' to yield about 500 plaques per plate. Plates were incubated at 37°C until plaques were 1 mm in diameter. Plaques were transferred onto a nylon membrane (Amersham Pharmacia Biotech, Piscataway, N.J.) and were hybridized with the adaA gene-specific probe according to the protocol provided by the manufacturer (Roche Diagnostics K. K.). The positive plaques were detected by using the digoxigenin luminescent detection kit (Roche Diagnostics K. K.). In vivo excision of the pBluescript vector along with the inserted DNA of each positive clone was performed according to the protocol of the supplier of the lambda ZAP II cloning system.
Immunoblot analysis of adaA expression in E. coli. E. coli containing the recombinant plasmid was cultured in LB supplemented with 4 mM IPTG (isopropyl-ß-D-thiogalactopyranoside) at 37°C overnight, and then cells were pelleted by centrifugation. The cell pellet was analyzed by SDS-PAGE and immunoblotting with rabbit anti-Nine Mile serum as described previously (30).
DNA sequence analysis. Plasmid DNAs from positive clones that expressed immunoreactive protein were isolated and purified by using the FlexyPrep kit (Amersham Pharmacia Biotech). The nucleotide sequence was partially determined by the dideoxy nucleotide chain-termination method with the Thermo Sequenase Cy5.5 dye terminator cycle sequencing kit and SEQ4x4 personal sequencer system (Amersham Pharmacia Biotech). A BLAST search against the complete genomic sequence of Nine Mile phase I (24) was achieved to identify the complete nucleotide sequence of the cloned gene. The nucleotide sequence and the deduced amino acid sequence were analyzed by the GENETYX analyzing system (Software Development Co., Ltd., Tokyo, Japan).
Detection of the adaA gene from various isolates of C. burnetii by PCR. A pair of primers, P28F and P28R, was designed based on the adaA gene sequence and used to amplify a 269-bp fragment (ranging from positions 369 to 637 in the open reading frame [ORF] region of the adaA gene) from DNAs of 17 isolates from various clinical and geographical sources. The sequences of the primers are as follows: P28F, 5'-AATAGATTCGCTCTCTCAAGCCG-3', and P28R, 5'-TCACCGCTGTTTTTTCAGACG-3'. PCR was performed with 2.5 U of Taq DNA polymerase (Invitrogen, Carlsbad, Calif.) in 50 µl of reaction mixture containing 20 ng of genomic DNA, 0.2 µM (each) primer, and 200 µM (each) deoxynucleotide triphosphates in 10 mM Tris-HCl (pH 8.3)-50 mM KCl-2.5 mM MgCl2. The reactant was subjected to 35 cycles of 30 s at 94°C, 30 s at 53°C, and 1 min at 72°C in a DNA thermal cycler (PTC-0200 DNA Engine; MJ Research, Inc., Waltham, Mass.).
Southern blotting. Restriction enzyme-digested DNAs from various clinical phenotypic isolates including two acute prototypic isolates (Nine Mile and Henzerling) and five chronic prototypic isolates (Priscilla, Q217, Q229, MAN, and ME) were tested by Southern blotting with the adaA gene-specific probe.
Expression and purification of the adaA fusion protein. The 602-bp DNA fragment of the adaA gene was amplified from C. burnetii Nine Mile DNA by PCR with primers P28EF-P28ER, which were designed from the adaA gene sequence and included 602 bp of the ORF region without the signal peptide-encoding sequence. Primer P28EF (5'-TTCGCTGCCACCGGATCCTTC-3') is the 5' end of the adaA gene with an additional BamHI restriction site, and primer P28ER (5'-ATCAACTCGAGGTTTCTTCG-3') is complementary to the 3' end of the gene with a XhoI restriction site in the sequence. The amplified adaA gene fragment was digested with BamHI and XhoI, ligated to expression vector pET23a, and then transformed into E. coli BL21(DE3)LysS competent cells. Expression of T7-tagged (N-terminal) and His-tagged (C-terminal) recombinant adaA (radaA) was induced by 4 mM IPTG. radaA was purified by using a ProBond resin column (Invitrogen) under denaturing conditions.
Antiserum preparation and immunoblot analysis of adaA among various strains of C. burnetii. The anti-adaA specific antibody was produced by immunization of BALB/c mice with purified radaA. Briefly, BALB/c mice (6 weeks old) were immunized with purified recombinant fusion protein in adjuvant (Titermax) three times at 14-day intervals. At each immunization, mice were subcutaneously injected with 50 µl of antigen (containing 20 µg of radaA) mixture with 50 µl of Titermax. After the third immunization, serum was collected and stored at 20°C.
The expression of adaA in various strains of C. burnetii was confirmed by immunoblotting with anti-adaA specific serum. SDS-PAGE and immunoblotting were performed as described elsewhere (31).
Reactivity of purified radaA with infection-derived sera. The reactivity of radaA with sera from guinea pigs infected with various strains of C. burnetii was analyzed by immunoblotting. Guinea pig serum was collected at 4 weeks post-aerosol infection with 106 organisms of the Nine Mile phase I, Ohio, Q217, or Q229 strain and stored at 80°C until use. C. burnetii Nine Mile whole-cell lysate and purified rCom1, which is a protein common to all isolates tested (29, 30), were used as a control to confirm the presence of the antibodies to C. burnetii antigens in infection-derived sera. SDS-PAGE and immunoblotting were performed as described previously (31).
|
|
|---|
24-kDa protein. Immunoblotting indicates that the protein expressed by clone p110 reacted with rabbit anti-Nine Mile serum (data not shown), suggesting that the clone p110-expressed recombinant protein is specific for C. burnetii.
![]() View larger version (32K): [in a new window] |
FIG. 1. Immunoblot analysis of purified OMPs of Nine Mile and Q217 strains with rabbit anti-Nine Mile hyperimmune serum. Lane 1, Nine Mile; lane 2, Q217.
|
![]() View larger version (52K): [in a new window] |
FIG. 2. Nucleotide sequence of the adaA gene. The deduced amino acid sequence is shown beneath the nucleotide sequence of the ORF. A putative promoter (positions 35 and 10) is underlined (thin line). The predicted ribosome-binding site (RBS) is underlined (thick line). The 20-amino-acid sequence at the N-terminal end of adaA is predicted to be a signal peptide. The chemically determined N-terminal 31-amino-acid sequence was identical to the N-terminal end of the deduced amino acid sequence of adaA.
|
![]() View larger version (52K): [in a new window] |
FIG. 3. Detection of the adaA gene from various isolates of C. burnetii by PCR with primers P28F-P28R. Shown is an ethidium bromide-stained agarose gel electrophoretogram of PCR-amplified products. Lane 1, molecular size markers (100-bp DNA ladder); lanes 2 to 9, isolates originating from ticks, milk, and humans with acute Q fever (Nine Mile, Ohio, California, El Tayeb, Africa, Panama, Turkey, and Giround, respectively); lanes 10 to 14, isolates originating from a goat and humans with chronic Q fever (Priscilla, KQ154, KoQ229, SQ217, and GQ212, respectively); lane 15, Dugway isolate.
|
28-kDa reaction band was detected from acute-disease-associated isolates Nine Mile and Henzerling but not observed in chronic-disease-associated isolates Priscilla and Q217 (Fig. 4C). This result confirmed that our cloned adaA gene encodes adaA and that adaA is expressed by acute-disease-associated isolates but not carried by chronic-disease-associated isolates.
![]() View larger version (43K): [in a new window] |
FIG. 4. Expression of the adaA gene in the pET23a expression vector system. Expression of the T7-tagged (N-terminal) and His-tagged (C-terminal) fusion protein was monitored by CBB staining of uninduced and induced cultures by SDS-PAGE and immunoblotting with His-tag-specific monoclonal antibody. (A) CBB staining profile of the expressed and purified fusion adaA protein. Lane M, molecular size markers; lane 1, pET23a-transformed E. coli (negative control); lanes 2 and 3, adaA gene recombinant pET23a-transformed E. coli uninduced and induced cultures, respectively; lane 4, purified fusion radaA. (B) Immunoblot analysis of expressed and purified recombinant proteins with His-tag-specific monoclonal antibody. The samples shown in panel B are the same as in panel A. (C) Immunoblot analysis of adaA in various strains of C. burnetii with adaA-specific antiserum. Lanes 1 to 4, whole-cell lysate of Nine Mile, Henzerling, Priscilla, and Q217 strains, respectively. A 28-kDa reaction band was observed in acute disease isolates including the Nine Mile and Henzerling strains but not detected in Priscilla and Q217. Numbers at left are molecular masses in kilodaltons.
|
![]() View larger version (50K): [in a new window] |
FIG. 5. Immunoblots of whole-cell antigen, rCom1, and radaA with sera derived from guinea pigs 4 weeks post-aerosol infection with 106 organisms of either the acute or the chronic prototypic isolate of C. burnetii. Sera (diluted 1:500) came from guinea pigs infected with Nine Mile (A), Ohio (B), Q217 (C), and Q229 (D). The samples shown in panels A to D are the same. Lanes 1, Nine Mile whole-cell antigen; lanes 2, purified rCom1 protein; lanes 3, purified recombinant adaA protein. Numbers at left are molecular masses in kilodaltons.
|
|
|
|---|
The predicted adaA mature protein consists of 227 amino acids and has a predicted molecular mass of 25,950 Da. This is very close to the molecular size of native adaA expressed in C. burnetii but about 2 kDa larger than the expression product of the adaA gene in E. coli (data not shown). The 25-amino-acid signal peptide is predicted in the N-terminal sequence of adaA, which is probably cleaved from the mature protein when the adaA gene is expressed in E. coli. The chemically determined N-terminal and internal peptide (data not show) amino acid sequences of adaA were identical to the deduced amino acid sequence of the cloned adaA gene, confirming that the identified ORF encodes adaA. The cloned adaA gene recombinant pUC19 expressed radaA in E. coli DH5
cells without induction by IPTG (data not shown). A potential promoter sequence, TTGAAT-21 nt-TGTTAT, was identified in the adaA gene sequence, suggesting that the adaA gene was expressed in E. coli by using the endogenous promoter. A BLAST search of GenBank with either the nucleotide sequence or the deduced amino acid sequence for the adaA gene did not identify significant DNA or amino acid homologies, suggesting that adaA is unique to C. burnetii.
OMPs of gram-negative bacteria are employed in several important roles in the host-parasite interaction and relate to both pathogenesis and protective immunity. Due to the difficulties in cultivation and purification of C. burnetii, only a limited group of OMP-encoding genes have been characterized (4, 16, 28). Candidates for OMPs include the QpH1 plasmid-specific gene cbhE' for a 42-kDa surface protein (15) and the QpRS plasmid-specific gene cbbE' for a 55-kDa surface protein (12-14), which have been speculated to be virulence related and associated with acute or chronic Q fever in humans. However, recent investigations of several European isolates suggested that there were no specific genes on plasmids responsible for acute or chronic Q fever (25-27) and supported the notion that host factors may play a key role in the development of chronic Q fever. It remains unknown whether there are specific genes on the chromosome responsible for acute or chronic Q fever. Isolates from acute disease are distinct from chronic-disease-associated isolates at the molecular level (3, 5, 22) and in a guinea pig fever model of acute disease (17; K. Russell, unpublished data), suggesting different virulence potentials for groups of isolates of C. burnetii. In this study, we identified a novel
28-kDa membrane-associated protein and demonstrated that adaA is expressed in acute group isolates but not carried by chronic group isolates, suggesting that adaA may be a virulence factor related to acute Q fever. Immunoblotting with purified radaA antigen recognized anti-adaA specific antibody from sera derived from animals infected with acute group isolates but not from sera from animals infected with chronic group isolates, suggesting that adaA is an important antigen in acute disease. Since there has been no suitable animal model developed to represent the manifestation of chronic Q fever and because there is a lack of genetic tools for C. burnetii, it is not possible to directly test whether a specific gene is related to acute or chronic disease. Recently, SCID mice have been used as a model highly sensitive to lethal challenge by an acute-disease-associated isolate of C. burnetii (1), and preliminary comparison in this model shows dramatic differences in disease from isolates which do not carry adaA (M. Andoh, unpublished data). Further studies to test whether the adaA gene can be delivered on a stable plasmid to a adaA-negative isolate may allow its role in virulence to be determined.
Since prompt antibiotic therapy could lead to a better prognosis for individual patients with chronic Q fever, developing a diagnostic method for rapid differential diagnosis of acute and chronic Q fever could be very important for control of chronic disease. Recently, based on point mutations unique to isolate groups, com1 and icd genes have been used as genetic markers to distinguish acute and chronic isolates (18, 29). However, comparison of nucleotide sequences of com1 and icd genes among isolates indicates that they are highly conserved between acute and chronic isolates, except for these few point mutations (18, 29). The finding that the adaA protein and the adaA gene are unique to acute group isolates can be used for development of radaA antigen-based serodiagnostic methods and/or an adaA gene-targeted PCR assay for differential diagnosis of acute and chronic Q fever in clinical samples. We have designed primers based on the nucleotide sequence of the adaA gene and used them to amplify products from DNA of various strains of C. burnetii. Amplicon products were amplified from DNA templates of isolates originating from humans with acute Q fever, ticks, cattle, and rodents but not from isolates originating from humans with chronic Q fever, suggesting that PCR for the adaA gene can be used for differentiation of acute- and chronic-disease-associated isolates. In addition, immunoblotting indicated that radaA reacted with sera derived from animals infected with acute group isolates but was not recognized by sera derived from animals infected with chronic group isolates, suggesting that an radaA antigen-based serodiagnostic test may be useful for differential diagnosis of acute and chronic Q fever in human sera. Further studies will evaluate the usefulness of an adaA gene-targeted PCR assay and an radaA antigen-based enzyme-linked immunosorbent assay for differential diagnosis of acute and chronic Q fever in clinical samples from acute and chronic Q fever patients.
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»