Previous Article | Next Article ![]()
Infection and Immunity, May 2005, p. 2611-2620, Vol. 73, No. 5
0019-9567/05/$08.00+0 doi:10.1128/IAI.73.5.2611-2620.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
Department of Anatomy and Physiology, College of Veterinary Medicine,1 Nuclear Magnetic Resonance Laboratory, Department of Biochemistry,3 Department of Human Nutrition, College of Human Ecology, Kansas State University, Manhattan, Kansas 665062
Received 4 October 2004/ Returned for modification 12 November 2004/ Accepted 9 December 2004
|
|
|---|
|
|
|---|
The defensin family is large and has been documented in mammals, plants, insects, and mollusks (6, 27, 29, 39, 47). In mammals, defensins are subdivided into
-, ß-, and
-defensins based on the organization of conserved six-cysteine motifs (43, 50). With the exception of bovine neutrophils, ß-defensins are synthesized primarily in epithelial tissues (18, 27). Because epithelia of the male reproductive tract are essentially isolated from adaptive immune capabilities and because the luminal contents of the testis and epididymis are of vital importance for the preservation of the species, it follows that these epithelia have developed immediate and rapid mechanisms to counteract urogenital pathogens.
Sexually transmitted diseases and infections of the urinary and reproductive tracts remain important public health problems worldwide. Although ß-defensins have been identified in the urogenital tract of several species, including humans (4, 12, 19, 27, 33, 38, 42, 52), mice (12, 32), rats (3, 9, 15, 36, 52), and nonhuman primates (2, 4), their existence in dogs has not been documented. Because of the clinical similarities in urinary tract infections between humans and dogs, this is a significant omission. For example, urinary tract infections are the most common infections in human hospitals and the second most common infections observed in the general population (13). Escherichia coli and Klebsiella pneumoniae represent the causative agents of 70 to 90% of all urinary tract infections in humans (16, 35, 40). This clinical feature is almost identical in dogs, where these two bacteria cause more than 80% of urinary tract infection cases reported in this species (26, 30, 44). Information on the antimicrobial peptide capabilities of the canine urogenital system may provide basic comparative knowledge for the development of novel therapeutic agents and treatments for urogenital infections.
Here we report the molecular cloning and identification of three ß-defensins from canine testicular tissues. These newly identified antimicrobial peptides effectively kill gram-positive and -negative bacteria and yeast in a salt-dependent manner. The presence of these antimicrobial peptides in the testicular tissue of a species that is remarkably resilient to sexually transmitted diseases strongly suggests that ß-defensins play a pivotal role in host defense mechanisms of the canine urogenital system.
|
|
|---|
|
View this table: [in a new window] |
TABLE 1. RACE and RT-PCR primers for canine ß-defensins
|
Synthesis and preparation of a cBD peptide.
A 34-amino acid peptide (KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPK) spanning the cBD cysteine motif was chemically synthesized (AC Scientific, Inc., Duluth, GA). The material eluted as a single peak on reverse-phase high-pressure liquid chromatography, and the peptide identity was confirmed by mass spectroscopy. The final purity of the peptide was 93% with a mass of 3,994.95 Da. The peptide was lyophilized and dissolved in 0.01% acetic acid at 2 mg/ml (
0.5 mM) as a stock solution and stored at 135°C until use. Formation of the three disulfide bonds was induced by air oxidation catalyzed by Cu2+ (52). Briefly, the peptide (2 mg/ml) was dialyzed in a 500-µl dialysis tube (molecular mass cutoff, 3,500 Da; Spectrum Laboratories, Inc., Rancho Dominguez, CA) at 4°C in 1 liter of 50 mM Tris-HCl (pH 8.0), 1 mM EDTA, and 1 mM dithiothreitol overnight. Dialysis bags were then transferred to 1 liter of 0.1 M NaHCO3, containing10 mM cysteine and 10 µM CuCl2. Oxidized peptides were dialyzed against 1 liter of 0.01% acetic acid for 4 h at 4°C and passed through a 0.2-µm-pore-size filter. The peptide concentration was determined with a BCA protein assay (Pierce, Inc., Rockford, IL). Human serum albumin (Sigma Aldrich, St. Louis, MO) was added to the peptide solution to achieve a final concentration of 0.1% immediately before the peptide was used.
Three-dimensional structure analysis of cBD. Structural models were generated for cBD via homology modeling. The target structure was predicted via alignment to a set of three human ß-defensin templates (isoforms 1, 2, and 3, respectively) for which experimental structural characterization was available (24, 42). Canine ß-defensin sequences were aligned to the human templates via the CLUSTALW program (48), using the Blosum 30 substitution matrix, a gap-opening penalty of 10, and a gap-extension penalty of 0.1. These resulted in multiple alignments, and the corresponding three-dimensional human ß-defensin peptide structures were then processed via the Modeller program (41) to yield structural predictions for the canine ß-defensin target. Modeller's default simulated annealing cycles were used for structural refinement. Analysis of the peptide secondary structure and surface characteristics was carried out on the resulting structures via SYBYL (SYBYL6.9.2,;TRIPOS, Inc., St. Louis, MO).
Antimicrobial activity. Candida albicans ATCC 11006 and 14053, Escherichia coli ATCC 25922 and 700336, Klebsiella pneumoniae ATCC 10031, Neisseria gonorrhoeae ATCC 10150, Listeria monocytogenes ATCC 19115, Staphylococcus aureus ATCC 10832, Ureaplasma canigenitalium ATCC 51252, and U. urealyticum ATCC 27619 were used for the microbicidal assays. C. albicans was grown overnight (35°C) to stationary phase on potato dextrose agar and managed as described by the NCCSL standards (33). U. canigenitalium and U. urealyticum were stored frozen (20°C) in urea broth 10B (per American Type Culture Collection specifications) and thawed at 5°C for 2 h before assay. N. gonorrhoeae was regularly maintained on chocolate agar, single strength BBL GC II agar base (Becton Dickinson, Sparks, MD) with 2% hemoglobin (BBL) and incubated at 37°C in 5% CO2. All other bacteria were maintained on Trypticase soy agar (Difco, Detroit, MI) plates at 37°C. N. gonorrhoeae and other bacteria were cultured to mid-logarithmic phase by transferring single cell colonies grown overnight into GC II agar base broth (36) or Trypticase soy broth (Difco), followed by incubation and shaking for 3 h at 37°C. Subcultures were centrifuged for 10 min at 4°C at 900 x g, and the bacterial pellets were washed once and suspended in 10 mM sodium phosphate buffer (PB [pH 7.4], [Na+] = 17.83 mM).
Initial bacterial concentrations were determined as previously described (12). N. gonorrhoeae at 108 CFU/ml was obtained at an optical density of 0.1 at 620 nm; the same initial population was estimated for the other bacterial cultures at an optical density of 0.1 at 600 nm. C. albicans were suspended in 10 mM PB to a McFarland standard of 0.5 for an initial 108 CFU/ml according to NCCLS recommendations (33), except that the recommended 0.85% saline solution was replaced with 10 mM PB. All microbial working dilutions were in 10 mM PB thereafter.
To determine the antimicrobial activity of cBD, a broth microdilution method adapted from the NCCLS methods (12, 33) was used as previously described (46). Briefly, 50 µl of the CBD working stocks were added to the wells of a microtiter plate in which 25 µl of 30 mM sodium PB (pH 7.4, [Na+] = 53.49 mM), 25 µl of H2O, and 50 µl of the microbial suspension had been previously combined. Microtiter plates were incubated at 37°C for 2 h in a shaking incubator (100 rpm), followed by the addition of 150 µl of the corresponding nutritive broth. Growth inhibition was determined by measuring MICs, defined as the lowest concentration in which microbial growth was prevented, as indicated by the lack of turbidity or color change (urea broth 10B) after 24 h of incubation at 37°C. Because N. gonorrhoeae does not show turbidity as evidence of growth in GC broth and because of its high autolytic activity in liquid medium, 50 µl was spotted onto chocolate agar and the MIC was defined as the lowest concentration at which no colonies developed after 24 h of incubation at 37°C in 5% CO2.
To determine the salt sensitivity of cBD bactericidal activity, two representative bacteria (one gram-negative and one gram-positive bacteria) were used; E. coli ATCC 25922 and L. monocytogenes ATCC 19115, respectively. The final sodium concentrations of the bactericidal mixture were adjusted to 15, 30, 50, 140, and 300 mM with NaCl. All assays were performed in triplicate.
Tissue expression of cBD mRNA. To determine the tissue expression of cBD genes, samples were obtained from healthy dogs according to procedures approved by the Kansas State University Institutional Animal Care and Use Committee, placed immediately in liquid nitrogen, and stored at 135°C until use. Testicular tissues were collected from three clinically healthy dogs. All dogs had a thorough clinical examination and preoperative screening, including hematology, blood chemistry, and urinalysis. All clinical laboratory results were within normal limits. No clinical signs of urogenital disease (i.e., urethral secretion, orchitis, balanitis, and cystitis) were present at time of the elective surgical procedure. Total RNA was extracted with TRI reagent (Sigma-Aldrich) after frozen tissues were ground in liquid nitrogen. A one-step reverse transcription-PCR (RT-PCR) was used to detect expression of cBD mRNA. Briefly, total RNA was treated with RQ1 RNase-free DNase I (Promega), and RNA samples (250 ng) were then used in a 25-µl RT-PCR mixture with 0.1 µM concentrations of each sense and antisense primer (Table 1). Conventional one-step RT-PCR was performed by using an AccessQuick RT-PCR System kit (Promega). Complementary DNA synthesis and predenaturation were performed for 1 cycle at 48°C for 45 min and 95°C for 3 min; amplification was carried out for 40 (cBD) or 25 (glyceraldehyde 3-phosphate dehydrogenase [GAPDH]) cycles at 95°C for 30 s, 55°C for 30 s, and 72°C for 30 s, and the final extension was at 72°C for 10 min in a 25-µl reaction mixture. After amplification, 10 µl of each reaction mixture was subjected to electrophoresis on 2% agarose gels, and bands were visualized by ethidium bromide staining. The efficiency of the RT procedure was standardized by assurance of comparable levels of the house-keeping gene GAPDH, amplified with PCR (51). For Southern analysis, RT-PCR products of cBDs were subjected to electrophoresis on 1.5% agarose gels and then capillary transferred overnight onto nylon membranes. Hybridization was performed with 32P-labeled cDNA probes generated from related fragments in the sequence-confirmed cBD cDNA clones. Probes were labeled with Prime-a-Gene Labeling System (Promega), and visualization of the signal was by exposure of X-ray films to the hybridized membrane.
To validate the RT-PCR and Southern analysis data, a two-step real-time RT-PCR assay was conducted. Briefly, RT was performed in 25-µl reactions by using optimal MgCl2 (
4 mM) in the first-strand buffer containing 50 mM Tris-HCl (pH 8.3) and 75 mM KCl. The priming oligonucleotides (40-pmol gene-specific primers) were annealed to 2.5 µg of total RNA in a total volume of 13 µl, incubated at 65°C for 5 min, and then cooled to 4°C. RT was performed by adding 7 µl of the RT mix such that the final concentration was 1x first-strand buffer, 0.5 mM deoxynucleoside triphosphate, 5 mM dithiothreitol, 40 U RNase inhibitor, and 200 U of superscript III reverse transcriptase (Invitrogen, Carlsbad, CA), and the mixture was incubated at 50°C for 60 min, heated to 70°C for 15 min, and cooled to 4°C. The reaction mixture of the subsequent PCR consisted of cDNA (250 ng), 0.5 µM concentrations of each primer, 1.5 µl of LightCycler Fast Start DNA Master SYBR Green 1 mix (Roche Diagnostics), and 4 mM MgCl2 in a total volume of 25 µl. Quantitative PCR was performed by using a SmartCycler system (Cepheid, Inc., Sunnyville, CA) and the following profile: stage 1, 95°C for 10 min; and stage 2, 95°C for 30 s and 58°C for 30 s, followed by an extension at 72°C for 40 s with the optic on at the primer annealing step. Stage 2 was repeated for 40 cycles. Stage 3 involved a melt curve assay that determined the specificity of the amplified PCR product. Analysis of amplification utilized increased fluorescence intensity of the reporter dye, SYBR Green, which was plotted against the cycle number. Threshold cycle (CT) was determined by exponential product amplification and determined from subsequent increased fluorescence intensity above background. The data were processed by using a standard curve generated with a series of doses of identical targets amplified at the same time.
In situ hybridization.
To localize cBD expression in canine testes, in situ hybridization was performed on tissues collected at the Kansas State University Veterinary Medical Teaching Hospital by using procedures approved by the Institutional Animal Care and Use Committee. Testicles were collected from clinically healthy dogs undergoing elective surgery (castration). All dogs were between 6 and 12 months of age. Briefly, testes were cut into
0.5-cm3 blocks, placed in 4% paraformaldehyde diethyl pyrocarbonate (DEPC)-treated phosphate-buffered saline (PBS; pH 7.5), and incubated at 4°C for 2 to 4 h with two changes of the same fixative solution. Fixed tissues were transferred to 30% sucrose-buffered, DEPC-treated PBS at 4°C overnight. Tissues were then stored in a freezing compound at 80°C until sectioning. Sections (15 µm) were prepared with a cryostat and attached to precoated slides (Fisher Scientific, Inc.). Cryosections were immediately postfixed with 400 µl of fixative on the slide for 5 min at 22°C. Sections were washed twice for 5 min each with DEPC-PBS and then permeabilized with 0.5 mg/ml of proteinase K (Roche Diagnostics) at 22°C for 10 min. Sections were then washed twice as described above and incubated in 2 mg/ml of glycine and PBS for 5 min. Tissues were treated with 0.1 M triethanolamine-HCl-0.25% acetic anhydride (vol/vol) for 10 min and equilibrated for 15 min in 5x SSC (0.75 M NaCl, 0.075 M sodium citrate). Prehybridization was conducted for 2 h at 55°C in prehybridization mixture (50% formamide, 5x SSC, 1 mg/ml of yeast tRNA, 200 µl/section).
To generate probe templates, 3'-RACE products of cBDs in the pGEM-T vector (Promega) were treated with HindIII and SpeI (Promega) resulting in the T7 polymerase promoter sequence linked to the isoform-specific 3'-terminal sequences at 180, 322 and 314 bp for cBD-1, cBD-2, and cBD-3, respectively. The remaining
80-bp shared regions after HindIII restriction were then removed by exonuclease III by using an Erase-a-Base System (Promega). The linearized plasmids were purified from agarose gel with a QIAquick gel extraction kit (Qiagen). Isoform-specific antisense probes were generated by using T7-polymerase (Roche Diagnostics) and sense probes were generated by using SP6-polymerase (Roche Diagnostics). Hybridization was carried out with the addition of 0.5 µg of labeled probe/µl in prehybridization solution at 55°C in a humidified chamber for 24 h. Slides were subsequently rinsed in 2x SSCT (2x SSC containing 0.1% Tween 20) twice at 50°C for 30 min each and then washed in 0.2x SSCT at 50°C for 30 min. Sections were blocked in 1% blocking reagent (wt/vol; Roche Diagnostics) in malate buffer (100 mM maleic acid, 150 mM NaCl [pH 7.5]) for 10 min, followed by incubation for 2 h with an anti-digoxigenin antibody conjugated to alkaline phosphatase (Roche Diagnostics) diluted 1:1,000 in blocking solution at room temperature. After a wash with 0.02% Tween-PBS (vol/vol) twice for 30 min, sections were equilibrated in color development buffer (50 mM Tris-HCl [pH 9.5], 100 mM NaCl, 50 mM MgCl2) for 5 min. The location of cBD transcripts was visualized by using antibody-conjugated alkaline phosphatase to catalyze the Fast Red TR-aphthol substrate (Sigma Fast AS-MX tablets; Sigma-Aldrich) at 22°C for 2 h. Slides were washed three times with DEPC-H2O for 10 min each, counterstained with probe-hematoxylin (Biomeda, Foster City, CA) for 2 min, and mounted with crystal-mount (Biomeda).
Nucleotide accession numbers. The nucleotide sequences reported here have been registered in GenBank under accession numbers AY169790, AY169791, and AY169792.
|
|
|---|
![]() View larger version (62K): [in a new window] |
FIG. 1. cDNA and predicted amino acid sequences for canine ß-defensins. (A) Canine ß-defensin cDNA sequences showing their identical 249 bp 5'-terminal regions (shaded black) and diversity at their 3'-terminal ends. ORFs are indicated with start (ATG) and stop (TGA) codons highlighted in red in each sequence. (B) Alignment of predicted pre-proprotein sequences of three canine ß-defensins. Identical amino acids are indicated as periods in cBD-2 and cBD-3. The cleavage site for a signal peptidase is indicated by the arrow. Conserved cysteine residues are boxed.
|
![]() View larger version (27K): [in a new window] |
FIG. 2. Comparison of deduced peptide sequences of canine ß-defensin mature peptide with congeners from humans and mice. Conserved cysteine residues are boxed. GenBank accession numbers are as follows: cBD1, -2, and -3, AY169790, AY169791, and AY16979, respectively; hBD-4, AJ314834; hBD-5, AB089180; hBD-6, AB089181; hBD-18, AY122471; hBD-22, AY122474; hBD-23, AY122475; Tdl (testis defensin-like), NP660139; and mBD-12, AB089182.
|
![]() View larger version (46K): [in a new window] |
FIG. 3. Secondary structure assignment and surface analysis for human and canine ß-defensins. (A) The leftmost column depicts ribbon diagrams showing -helix (purple), ß-sheet (yellow), and coil (turquoise) secondary structure elements for the four peptides. (B) The two rightmost columns depict front and back views of peptide solvent accessible surfaces. Acidic (anionic) residues are red, basic (cationic) residues are blue, and hydrophobic residues are yellow.
|
|
View this table: [in a new window] |
TABLE 2. Antimicrobial activity of canine ß-defensin
|
15 mM NaCl), with MICs of 20 and 10 µg/ml for E. coil and L. monocytogenes, respectively, was inhibited at higher salt concentrations. At 140 mM [Na+] in the assay mixture, the MIC of cBD (for both bacteria) increased 10- to 40-fold. These findings are in agreement with those of the salt sensitivity evaluations of other ß-defensins (3, 19, 32, 52).
![]() View larger version (21K): [in a new window] |
FIG. 4. Effect of sodium chloride on antimicrobial activity of canine ß-defensin. A broth microdilution method was used to determine the MIC of cBD against two strains of bacteria, gram-negative E. coli (ATCC 25922) and gram-positive L. monocytogenes (ATCC 19115) in various salt concentrations. The final sodium concentration of the bactericidal mixture was adjusted to 15, 30, 50, 140, and 300 mM with NaCl. All assays were performed in triplicate.
|
![]() View larger version (42K): [in a new window] |
FIG. 5. Tissue expression of canine ß-defensins. (A) Fragments of cDNA were amplified from total RNA (250 ng) with one-step RT-PCR (40 cycles) with the primers listed in Table 1 and hybridized with 32P-labeled probes generated from cloned cDNA with the same primers. cDNA fragments of GAPDH were amplified (25 cycles) with the same RNA samples as a control. (B) Real-time RT-PCR of cBD-1 mRNA. Total RNA (250 ng) was reverse transcribed into cDNA and quantified with a SYBR Green-based PCR on a SmartCycler. Specific amplicon concentrations were normalized by using threshold cycle values against standard curves generated by using the same PCR conditions with serial dilutions of the cloned cBD-1 cDNA fragments.
|
![]() View larger version (111K): [in a new window] |
FIG. 6. Localization of canine ß-defensin mRNA in normal canine testes. Frozen sections of canine testes were analyzed by in situ hybridization with digoxigenin-labeled antisense (A to I) and sense (J and K) probes. Panels C, F, and I are higher-magnification images of the framed regions in panels B, E, and H, respectively. Red precipitates are the products of anti-digoxigenin antibodies conjugated with alkaline phosphatase catalyzing Fast Red (Sigma-Aldrich) substrates and indicate locations of hybridized mRNA by the cBD probes. (L) RNase-treated control. The sections were counterstained with hematoxylin. T.A., tunica albuginea; S.T., seminiferous tubules; S., septa; S.C., Sertoli cells; L.C., Leydig cells.
|
|
|
|---|
Typically, ß-defensin genes are comprised of two exons and an intermediate intron. The first exon encodes the prepro-region, and the second exon encodes the mature peptide (43). The pre-proproteins are processed into the mature peptides, which are generally composed of 36 to 47 amino acids. However, two groups of ß-defensins do not fit this pattern. One group is comprised of the three alternate splicing variants of the human HE2/EP2 gene, EP2C, EP2D, and EP2E, which all share the conserved cysteine motif of ß-defensins. Their peptide precursors are composed of 113, 133, and 80 amino acid residues, respectively (9, 14, 15, 43). The second group resides among the five newly identified human ß-defensin genes (DEFB25 to DEFB29) clustered on chromosome 20p13; the longest, DEFB-29, is 183 amino acids, and DEFB-25 to 28 are at 156, 111, 99, and 93 amino acids, respectively (38). The additional length of these ß-defensin isoforms is generated mostly through extensions in the carboxy terminus following the consensus cysteine motifs. The three cBDs reported here exhibit similar C-terminal extensions. In comparison to other ß-defensins, cBD-1 and cBD-2 are within the average length of most; however, cBD-3 is longer due to its 34 additional amino acids at the C terminus. The function of these additional C-terminal amino acids is unknown. One possibility is that they serve as a regulatory domain to promote the attachment of the antimicrobial peptide to the membrane of bacteria. Alternatively, the two longer isoforms, i.e., cBD-2 and cBD-3, might be testis-specific storage antimicrobial peptides. We theorize that they may act as endogenous antimicrobial molecules by providing immediate access to a gene product that could be rapidly processed into a shorter active isoform, i.e., cBD-1, when it is required. In this case, the C-terminal extension may, in fact, protect the stored peptides from degradation or unnecessary antimicrobial activity.
The structural analysis revealed that the global folding of cBD assumes all of the common features of the ß-defensin family, such as three disulfide bonds, three antiparallel ß-sheets and an
-helix usually located near the N-terminal of the peptide (Fig. 3A). cBD also displayed another essential feature common in all ß-defensins which was the high concentration of cationic residues (Fig. 2). The number of positively charged residues (Arg, Lys, and His) reported in the mature peptides of other mammalian ß-defensins (range, 6 to 14; average, 9) (43) was in good agreement with the number of cationic amino acid residues (6 Lys, 2 Arg; n = 8) found in the cBD sequence (Fig. 2 and 3B). It has been proposed that this high cationic charge density enables ß-defensins to bind and insert into the cellular membrane, leading to the killing of the microorganism by forming multiple membrane pores (55). Our findings on the surface analysis of the cBD (Fig. 3B) established three well-defined cationic areas that may allow potent electrostatic interactions with bacterial membranes, furnishing cBD with the broad antimicrobial spectrum demonstrated in the in vitro assays.
Bacteria used in the present study were selected based on their ability to produce urinary tract infections (uropathogenic E. coli and K. pneumonia) and sexually transmitted diseases (N. gonorrhoeae, C. albicans, U. urealyticum, and U. canigenitalium). The antimicrobial effect of cBD was also evaluated against L. monocytogenes, S. aureus, and E. coli according to previous reports that have used these bacteria in assays of antibacterial activity for novel antimicrobial peptides (25, 34, 52). cBD effectively killed gram-positive and -negative bacteria, yeast, and Ureaplasma spp. The antimicrobial activity of cBD was comparable to that reported for other synthetic or natural ß-defensin peptides, such as mBD-12, hBD-1, and hBD-3 (22, 49, 52). More importantly, synthetic cBD was more effective in killing C. albicans isolated from vaginal epithelium than one isolated from hematogenous origin, strongly suggesting that cBD plays an essential role as an epithelium-derived antibiotic that functions as an immediate line of defense against genital pathogens. The MIC for cBD for C. albicans is in agreement with previous reports (7, 23). Similar to other ß-defensins (17), the bactericidal activity of cBD is dependent on the salt concentration used in the in vitro assay (52). Furthermore, our data suggest that the C termini of cBD-2 and cBD-3 may not be necessary for antimicrobial activity. Future studies will be required to determine differences in antimicrobial activities of the cBD isoforms and to investigate their individual role in relation to urogenital infections.
The biological activity of ß-defensins is not limited to direct killing of microorganisms (1, 5, 6, 9, 43). These epithelium-derived molecules also participate actively in other aspects of adaptive immunity, including chemotactic effects on immature dendritic cells and memory T cells exerted through the CCR6 receptor pathway (53, 54). Despite the lack of information about the RNA expression pattern of cBDs in other epithelial surfaces of the canine urogenital tract, the results from the present study allow us to propose a speculative scenario. Considering that the expression of the shortest isoform, cBD-1, was not restricted to the testis, it is likely that this ß-defensin may work in conjunction with other epithelial components of the mucosal barrier of the collecting ducts, ureters, bladder, and urethra to counter bacterial invasion of the urogenital tract. Conversely, the two longer cBD isoforms (cBD-2 and cBD-3) may diffuse to the site of infection, actively orchestrating chemotactic signals that direct the migration of circulating cells needed to initiate an adaptive immune response at the site of inflammation. The fact that uropathogenic E. coli and K. pneumoniae (the two bacterial strains that account for up to 90% of the urinary tract infections in humans and dogs) were sensitive to cBD supports the hypothesis that this epithelium-derived defensin may be also expressed in urinary tract epithelia.
The existence of multiple ß-defensin isoforms in the male reproductive tracts of humans, rats, and mice (10, 20, 28, 52) suggests that these antimicrobial cationic peptides might specifically and cooperatively contribute to protect the reproductive system against pathogenic microbes. The presence of three different testis-specific cBDs isoforms suggests synergistic peptide function might also occur in the male dog. cBD-1, which displayed a more ubiquitous tissue expression pattern, could be the primary endogenous antibiotic line of defense against bacterial invasion in testis and other epithelial surfaces (i.e., lung, and small intestine). The two testis-specific ß-defensins (cBD-2 and cBD-3) could possibly interact with cBD-1, providing a synergistic antimicrobial effect, thus rendering enhanced local protection to the canine reproductive system.
It is worth noting that only a few bacterial sexually transmitted diseases (Mycoplasma, Ureaplasma, and Brucella spp.) occur with any frequency in male dogs. Moreover, a direct relationship between these pathogens and clinical signs has not been fully documented and remains controversial (8, 11, 21). Our results clearly showed that cBD possesses broad antibacterial effects against the sexually transmitted disease pathogens used in the present study. cBD also effectively killed two strains of C. albicans; however, Ureaplasma spp. appeared to be resistant to cBD. This fact may be explained by the cell membrane composition of Ureaplasma spp. Ureaplasma spp. are among the few bacteria that possess a higher concentration of cholesterol within their cell membranes, protecting them from the antibacterial activity of defensins (21, 37). It has been suggested that eukaryotic cells are more resistant to the pore-forming effects of defensins due to the presence of cholesterol in the cellular membrane (56). The lack of cBD killing effect may explain why Ureaplasma is commonly isolated from the canine genital tract, where it is present as normal microflora (21).
Previous studies have reported that N. gonorrhoeae is very sensitive to protregrins (antimicrobial peptides derived from porcine neutrophils) but resistant to several human
-defensins (45). Our results conclusively showed that N. gonorrhoeae is killed by cBD. This inconsistency could reflect species-specific differences or more likely the site of defensin production; cBD is of epithelial origin (the first site of contact for a sexually transmitted disease pathogen), whereas most
-defensins are produced by circulating blood cells, which most likely are not the primary contact tissue for genital pathogens.
Several microbial pathogens are able to invade and colonize reproductive tract tissues and semen. If successful, they may cause serious clinical consequences to the reproductive status of the individual. Therefore, innate immunity should play a crucial role against bacterial invasion of the urethra, epididymis, and testes to protect and preserve the spermatozoa. Anatomically, the epididymis is the continuation of the urethra, exposing it to a permanent risk for ascending microbial infections. Our in situ hybridization results clearly showed that cBD-1 and cBD-3 are expressed in Sertoli cells (supporting cells for the developing spermatozoa), suggesting that these epithelium-derived peptides may actively participate as local antimicrobial molecules keeping the environment sterile for adequate sperm development and maturation. Moreover, these results are in agreement with previous reports showing the expression of ß-defensins in the epididymis and seminiferous tubules, chiefly Sertoli cells, of the reproductive tract of rats (10, 31).
In summary, we have cloned the full-length cDNA of three canine ß-defensinscBD-1, cBD-2, and cBD-3from testicular tissues. Canine ß-defensin has broad antimicrobial activity, particularly against pathogens of the urogenital tract. The expression pattern of cBDs in Sertoli and Leydig cells of the testis suggests that they play a role in host defense of the male reproductive tract. In light of the pattern of expression and activity of canine ß-defensins, further studies are warranted to investigate the role of ß-defensins in host defense and the physiological function of the male reproductive system.
This study was supported by National Institutes of Health Grant P20 RR017686 (T.M.) from the Institutional Development Award Program of the National Center for Research Resources.
|
|
|---|
, new members of an epididymis-specific family of androgen-regulated proteins in the human. Endocrinology 141:1245-1253.
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»