Previous Article | Next Article ![]()
Infection and Immunity, August 2006, p. 4932-4938, Vol. 74, No. 8
0019-9567/06/$08.00+0 doi:10.1128/IAI.00442-06
Copyright © 2006, American Society for Microbiology. All Rights Reserved.
Laboratory of Molecular Parasitology and Immunology, Department of Microbiology, University of Puerto Rico, School of Medicine, San Juan, Puerto Rico
Received 17 March 2006/ Returned for modification 14 April 2006/ Accepted 13 May 2006
|
|
|---|
|
|
|---|
Recently, we described the molecular cloning and expression of an F. hepatica antigen termed FhSAP-2, which is expressed at early stages of infection and which, by its structural homology with a F. hepatica NK-lysin (20), three amoebapores of Entamoeba histolytica (14), a porcine NK-lysin (1), and several other related proteins (3, 23), falls in the saposin-like/NK-lysin protein family of F. hepatica. It is an 11.5-kDa polypeptide that elicits a strong antibody response during active infection and exhibits a potent lytic activity against human erythrocytes and peripheral blood mononuclear cells (7), which stimulates specific cell-mediated and humoral immune responses (6). This novel antigen is highly reactive with sera from rabbits experimentally infected with F. hepatica, and it is recognized by more than 83% of sera from patients with chronic Fasciola infection (7). We have also found that FhSAP-2 is a potent immunogen, since rabbits vaccinated with FhSAP-2 and challenged with F. hepatica metacercariae had lower parasite burdens, fewer parasite eggs, and less liver damage than nonvaccinated controls (8). However, the immune mechanism that made this protection possible is not clear. Correct identification of epitopes in FhSAP-2 will greatly help in the characterization of targets for immunization-vaccination and may provide an antigen basis for designing diagnostics specific for F. hepatica. The aim of this study was to identify linear B-cell epitopes of FhSAP-2 by screening a synthetic peptide library based upon this protein with sera from rabbits immunized with FhSAP-2 and rabbits infected with F. hepatica using an enzyme-linked immunosorbent assay (ELISA) and a peptide ELISA inhibition assay. Similar studies have been carried out on other antigens associated with Fasciola and related parasites with success (4, 24, 30).
Recombinant protein and animal sera. Recombinant FhSAP-2 was purified from transformed Escherichia coli TOP10 competent cell inclusion bodies, solubilized in 6 M guanidine hydrochloride, and then purified by affinity chromatography through a HiTrap Ni2+ chelating column (Amersham Biosciences Corp, New Jersey) as previously described (7). Purified protein was analyzed by conventional sodium dodecyl sulfate-polyacrylamide gel electrophoresis and identified by Western immunoblotting using a specific polyclonal antiserum (7). Eighteen peptides representing the entire 101-amino-acid sequence of FhSAP-2 were synthesized by standard 9-fluoroenyl-methoxicarbonyl polyamide solid-phase synthesis. The quality of peptides was assessed by reverse-phase chromatography on a Supelco Bio Wide Pore column and by matrix-assisted laser desorption ionization-time of flight mass spectrometry. Peptides were synthesized as 15 mers, with adjacent peptides overlapping by 10 amino acids and termed sequentially as SAP-1 to SAP-18. The last C terminus peptide (SAP-18) was synthesized as a 16 mer.
All experiments were performed with eight 3-month-old male New Zealand White rabbits (Harland Inc., Indianapolis, Ind.) and nine Swiss male mice (Biomedical Research Institute, Maryland) which were maintained in the animal care facility at the University of Puerto Rico, Medical Sciences Campus, and treated according to international regulations for the care of laboratory animals. Rabbits were orally infected with 25 F. hepatica metacercariae each (Baldwin Aquatics Inc., Monmouth, Oreg.) and necropsied 12 weeks after infection. Mice were infected with 150 S. mansoni cercariae by skin penetration and necropsied 9 weeks after infection. Rabbits and mice were bled before infection and then biweekly until necropsy for collection of serum. Sera from rabbits and mice were tested by ELISA against FhSAP-2 following a preestablished protocol (9). FhSAP-2 reacted strongly with sera from rabbits at 4 weeks (0.23 ± 0.06) to 12 weeks (1.76 ± 0.012) postinfection with F. hepatica, and it was also reactive with sera from mice at 4 weeks (0.18 ± 0.06) to 9 weeks (0.76 ± 0.015) postinfection with S. mansoni.
B-cell epitope prediction. Because most, if not all, antigenic sites are located within surface-exposed regions of a protein, the presence of B-cell epitopes is often predicted by computer analysis based on measurement of hydrophobicity (17), hydrophilicity and surface accessibility (21), antigenic index (13), and predicted helix or turns (11). Using the deduced amino acid sequence of the cDNA encoding FhSAP-2, these predictions revealed the presence of several putative antigenic regions randomly distributed throughout the protein (Fig. 1A to C), with the exception of the first 15 amino acid residues at the N terminus. This region exhibits the highest hydrophobic index. It has been predicted that this region contains a string of hydrophobic and hydroxylic amino acid residues that were predicted to constitute an N-terminal signal sequence with a signal cleavage site between amino acids Ala15 and Ser16 (7). Therefore, it is possible that this region may be absent in the mature protein, which could eventually explain the lack of reactivity between peptides containing residues 1MNPLFVLMLAAVTFASFDVP20 and sera of infected animals. A prediction of the secondary structure of FhSAP-2 is shown in Fig. 1D.
![]() View larger version (28K): [in a new window] |
FIG. 1. (A) Prediction of hydrophobicity. >0, high hydrophobicity; <0, low hydrophobicity. (B) Solvent accessibility. 0, low accessibility; 9, high accessibility. (C) Antigenic index. Values of >0 indicate potential antigenic regions. Regions of low hydrophobicity have more solvent accessibility and a higher antigenic index. (D) Secondary structure predicted for the protein moiety of FhSAP-2 (GenBank accession no. AF286903).
|
![]() View larger version (35K): [in a new window] |
FIG. 2. Mapping analysis using peptides spanning the entire sequence of the protein the FhSAP-2. For this experiment ELISA plates were coated with 20 µg/ml per well. Rabbit and mouse sera were tested at dilutions of 1:200. To visualize specific peptide-antibody reactions, peroxidase-labeled anti-species immunoglobulin G (Bio-Rad Laboratories, Hercules, CA) conjugate, diluted 1:5,000, was used. Individual peptides were tested with two specific anti-FhSAP-2 sera (A), eight sera from rabbits at 12 weeks postinfection with Fasciola (B), and nine sera from mice at 9 weeks postinfection with S. mansoni (C). Serum was considered positive when its OD at 492 nm exceeded the previously established cutoff value (cutoff, 0.19), which was calculated as the mean absorbance plus two standard deviations of the negative rabbit or mouse sera. Numbers above columns indicate the number of sera reacting with a given peptide. An asterisk over the bar indicates statistical difference (P > 0.05) between mean absorbance values with infected sera and negative sera for each specific peptide.
|
![]() View larger version (28K): [in a new window] |
FIG. 3. Inhibition percentage obtained when peptides were individually added at 20 µg/ml to sera from rabbits at 12 weeks postinfection with F. hepatica. For this assay two pools of peptides were prepared. Pool 1 included the N terminus peptides (SAP-1 to SAP-9), and pool 2 included the C terminus peptides (SAP-10 to SAP-18). Microtiter plates were coated with 20 µg/ml of each pool of peptides. Serum diluted 1:200 was mixed with 20 µg/ml of a single peptide and incubated for 1 h at 37°C to favor peptide-antibody complex formation. After incubation, a serum-peptide mixture was added to the plates and incubated for 1 h at 37°C. Conjugate was then added, followed by the substrate solution as previously described (9). Percent inhibition (I) was calculated as follows: I = [1 (OD at 492 nm of serum-peptide mixture/OD at 492 nm of serum-PBS-Tween mixture)] x 100. Peptides that inhibited the binding capacity of antibodies to antigen-coated plates by >50% were considered distinctive of dominant B-cell epitopes. The three antigenic regions identified within the FhSAP-2 protein are enclosed in a box. The amino acid residues that were considered to contain dominant B-cell epitopes are in bold type.
|
The last antigenic site (site 3) was considered to be in residues 66RSQDACIEFVQQEVDYIIDHVDQHNATEICRLIKLC101 of peptides SAP-12, SAP-13, SAP-14, SAP-15, SAP-16, SAP-17, and SAP-18. All sera gave low OD values (between 0.26 to 0.35) with peptides SAP-12, SAP-13, SAP-14, SAP-17, and SAP-18 but gave moderate to high OD values (between 0.43 to 0.8) with peptides SAP-15 and SAP-16, which contain the amino acid residues 76QQEVDYIIDH85 as part of their sequence. Peptide SAP-15 shared the residues 71CIEFV75 with the less immunoreactive peptide SAP-14, and peptide SAP-16 shared the residues 81YIIDHVDQHN90 and 86VDQHN90 with the poorly immunoreactive peptides SAP-17 and SAP-18, respectively. Because peptides SAP-15 and SAP-16 were the only peptides from this group that inhibited antibody binding to a peptide-coated plate by more than 50%, we concluded that the region spanned by amino acid residues 76QQEVDYIIDH85 is a dominant B-cell epitope (Fig. 3).
Quantitative comparison between both dominant B-cell epitopes demonstrates that sera were significantly (P < 0.05) more reactive with the dominant B-cell epitope of site 1 (N-terminal portion of protein) than with the dominant B-cell epitope of site 3 (C-terminal portion of protein). It is necessary to note that, unlike peptides SAP-4, SAP-5, (from the N-terminal region), and SAP-16 (from the C-terminal region) that were the only peptides that reacted with most sera, the other antigenic peptides from the antigenic site 1, site 2, and site 3 were not recognized by most of the positive sera tested (Fig. 2B). This suggested that it will not be possible to further define or shorten the epitopes SKQPTIDIDL, ADQTVEEHIG, and QQEVDYIIDH, since shortening of the peptide in these regions will probably result in decreasing the OD reading or elimination of the reactivity with some sera. Similar results have been reported by other investigators (27) and may occur because some antibodies in a particular serum react more avidly with certain amino acid residues than with others within the epitope. This would mean that a shortened peptide may react only with a portion of FhSAP-2 antibodies present in a particular serum, resulting in a weak-positive or false-negative reaction. Previous studies relating to the epitope mapping of Mycoplasma bovis surface lipoproteins have shown B-cell epitopes to be around three to seven amino acid residues long (22). However, other studies have shown reactive B-cell epitopes relating to fungal, bacterial, or parasitical antigens to be as long as 10 or even 15 residues (15, 27, 28, 29, 30), similar to the size of the 10-mer SKQPTIDIDL, ADQTVEEHIG, or QQEVDYIIDH described here.
As with all proteins belonging to the saposin-like/NK-lysin protein family, FhSAP-2 possesses six conserved cysteine residues as well as seven conserved hydrophobic residues, which are within five amphipathic
-helix domains (1, 18, 20, 23, 25). The number and the positioning of cysteine residues in this family strongly suggest a common structural organization among these proteins and indicate that a favorable tertiary structure that combines amphipathic
-helices with folding of a disulfide bond is conserved (7). An important observation of this study is that the immunoreactivity of the B-cell epitopes mapped on FhSAP-2 was found to be inversely related to the number of hydrophobic residues that include its sequence. That is, peptide SAP-7 (residues 32DICTNTMDVIKKML45), SAP-11 (residues 51EEHIGYLVKYLCKIA65), SAP-17 (81YIIDHVDQHNATEIC95) and SAP-18 (86VDQHNATEICRLIKLC101), which are the less immunoreactive peptides, span each one, three, or four conserved hydrophobic residues (underlined). Similarly, peptides SAP-8, SAP-9, and SAP-10 (36NTMDVIKKMLADQTV50, 41IKKMLADQTVEEHIG55, and 46ADQTVEEHIGYLVKY60, respectively), which cover the central part of the protein moiety and exhibit a moderate immunoreactivity, span two conserved hydrophobic regions. By contrast, peptides that were highly immunoreactive, specifically SAP-4 and SAP-5 (residues 16SFDVPSKQPTIDIDL30 and 21SKQPIDIDLCDICT35) do not span any hydrophobic conserved residues in their sequences. Nevertheless, the highly immunoreactive peptide SAP-16 (residues 76QQEVDYIIDHVDQHN90) includes a conserved hydrophobic residue (86V), but this residue is not included within the dominant epitope (76QQEVDYIIDH85). Another interesting observation is that, while the highly reactive N-terminal (residues 21SKQPTIDIDL30) dominant B-cell epitope is totally located in an extended region, the C-terminal dominant B-cell epitope (residues 76QQEVDYIIDH85), which is less reactive, is partially located in an
-helical region. These observations are consistent with the concept that extended regions have a stronger influence than helical regions on the outcome of the antibody recognition (28).
In our previous studies with FhSAP-2, we demonstrated that reduction of disulfide bonds with dithiothreitol (DTT) notably reduced the reactivity of protein with serum from infected animals (7). To determine if the antigenic regions described in the present study are reduction sensitive, DTT was added to single peptides following an established protocol (7). Then, sera from Fasciola- or Schistosoma-infected animals were tested by ELISA against peptides treated with DTT and untreated peptides. Interestingly, no diminution of reactivity against sera was observed even on high DTT concentrations (data not shown). This suggests that, in addition to the lineal epitopes described in this study, other conformational epitopes are necessarily formed in the native protein. Also, since FhSAP-2 is potentially a glycoprotein, as predicted from the deduced amino acid sequence (7), the carbohydrate portion of the molecule is likely to contain antigenic determinants that cannot be identified using this methodology. In our previously published study, we demonstrated that the lytic activity of FhSAP-2 is not a property ascribed to the conserved cysteine residues (7). Here, we found that neither of the hydrophobic conserved regions is immunoreactive. This experimental evidence supports the hypothesis that either the immunoreactivity with sera or the lytic activity of FhSAP-2 could be functions associated with the nonconserved residues present in the
-helix bundles themselves or, alternatively, with the unrelated regions connecting each helix rather than associated with the conserved regions.
Computer algorithms (10) applied to the primary structure of FhSAP-2 have predicted the existence of at least five potential major histocompatibility complex class II binding regions with their corresponding P1 anchor region contained in the
-helix regions, as well as regions that might form T-cell epitopes. Antigenic sites described in this study may interact with such helper T-cell epitopes, influencing the repertoire and specificity of antibody-producing cells. If this is the case in the antibody response to FhSAP-2, differences in the response elicited by the antigenic site may affect properties of other sites, which remain to be further investigated. It must be noted that the epitope mapping techniques used in the present study are limited to the identification of linear (continuous) epitopes defined by contiguous amino acid residues in the primary structure of the protein. In addition to the linear epitopes described herein, other discontinuous epitopes, defined by the interaction between amino acid residues that are distant in the protein sequence but brought together as a result of the natural folding of the protein, may be found on FhSAP-2 in its native conformation.
Immunogenicity of dominant B-cell epitopes. To ascertain whether dominant epitopes are able to induce specific antibodies, peptide SAP-4, which contains the dominant epitope at residues 21SKQPTIDIDL30, and peptide SAP-16, which contains the dominant epitope at residues 76QQEVDYIIDH85, were coupled to keyhole limpet hemocyanin (Pierce, Rockford, Ill.) and used to immunize two BALB/c mice. The immunization schedule consisted of three subcutaneous injections at biweekly intervals of 70 µg each in phosphate-buffered saline (PBS), mixed with an equal volume of Freund's adjuvant (complete for initial dose; incomplete for booster injections). Two weeks after the last injection, animals were anesthetized, bled, and sacrificed to remove the spleen. Analysis of the resulting antisera revealed that both peptides were highly immunogenic and elicited titers of anti-peptide antibodies higher than 1:25,000. Anti-SAP-4 and anti-SAP-16 sera recognized the free peptides bound to the wells of microtiter plates in either a dose-dependent or saturable manner. The specificity of the reaction was demonstrated by the fact that each soluble peptide was an effective competitor of binding of the anti-peptide antiserum to the same peptide immobilized in the wells of a microtiter plate and was able to abolish binding at high concentrations (data not shown).
Specific B-cell receptor identification. The spleens from immunized mice were washed and minced in PBS. After centrifugation for 10 min at 1,000 x g, red blood cells were removed by hypotonic lysis for 30 s, and the resulting suspensions were washed, centrifuged, and cultured for 2 days with optimum concentrations of each free peptide. Using standard protocols, stimulated cells were stained for fluorescence-activated cell sorter analysis with fluorescein isothiocyanate (FITC)-conjugated anti-CD19 or with phycoerythrin-Cy7 (PE-Cy7)-conjugated anti-CD69 (Pharmigen, San Diego, CA). As was expected, the vast majority of cells derived from animals immunized with peptides SAP-4 and SAP-16 stained specifically with anti-CD19, from which 93.2% and 99.41%, respectively, stained also with anti-CD69 (Fig. 4), which demonstrated that cells marked for CD19 were activated. Since CD19 is a characteristic B-cell marker expressed from the early stages of commitment to B-cell lineage and on all mature B cells, the large number of activated cells expressing this marker indicates that the sequences 21SKQPTIDIDL30 and 76QQEVDYIIDH85 from FhSAP-2 are actually B-cell epitopes.
![]() View larger version (21K): [in a new window] |
FIG. 4. Peptides SAP-4 and SAP-16 contain, respectively, the immunodominant B-cell epitopes 21SKQPTIDIDL30 and 76QQEVDYIIDH85. They were conjugated with keyhole limpet hemocyanin, emulsified in Freund's adjuvant, and injected separately into two mice. Splenocytes were isolated from each immunized animal and cultured in triplicate at 106 cells/well in 200 µl of RPMI-1640 medium supplemented with 10% fetal bovine serum and 1% penicillin-streptomycin and stimulated with 5 µg/ml of each peptide. Cells were incubated for 48 h at 37°C under 5% CO2 atmosphere. After incubation, cells were centrifuged, washed with PBS, stained with anti-CD19-FITC or anti-CD69-PE-Cy7 (BD Pharmigen, San Diego, CA) monoclonal antibodies, and analyzed by fluorescence-activated cell sorting using a FACSort (Becton and Dickinson, San Jose, CA) instrument. Splenocytes were identified by their characteristic appearance on a dot plot of forward scatter versus side scatter. Splenocytes stained with FITC- or PE-Cy7-labeled antibodies were detected by FL1 or FL3, respectively. B-cells were gated on the basis of CD19 staining. The results were reported as the percentage of positive cells within this gate that appear activated.
|
We thank Cynthia Rivera for her help in statistical analysis and Laura Bretaña for her excellent editorial assistance.
|
|
|---|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»