TABLE 7.

Non-A23/L6 Fabs: L chainsa

FabSequence of L chainJκ
CDR1CDR2CDR3
Vκ L5RASQGISSWLAAASSLQSQQANSFP
    008.4B7-----V-Q--GDVF--HG--TK--- HTJκ2
Vκ A2KSSQSLLHSDGKTYLYEVSNRFSMQSIQLP
    023.115R----------R--FH----------M-Y RTJκ1
  • a H- and L-chain CDRs and isotypes of the two non-A23/L6 Fabs isolated in this study. Fab 008.4B7 has a two-residue insertion in H-chain CDR1; a space was inserted at the appropriate location of the germ line sequence for purposes of alignment (as indicated by asterisks, see Table 8). Donor 008 received the conjugate vaccine. Donor 023 received the 23-valent PPS vaccine.