TABLE 2.

Brucella suis proteins released in acidic supernatant

No.N-terminal sequenceaB. suis protein characteristicsB. melitensis homologued (chromosome and no.)Putative functioneOther bacterial homologuef
MassbSignal peptideaSpeciesIdentity (%)
ExpTh.B. suisB. melitensis
1ESTTVKMYEALPTGPGKEV1816.119II 0703II 0581Cu/Zn SOD Salmonella enterica serovar Typhimurium62
2/ChvEEDKGLVAVAMPTKSSA3535.821II 0937II 359/360Multisugar A. tumefaciens 80
3/RibEGLMTIIVNDPSNPYWFTEGEVAKKTAEGLGY3130.625II 0858II 0435 d-Ribose Y. pestis 80
4/NopKEWKEIRIASEGAYPPFNYM3030.825II 0632Arginine/ornithine Mesorhizobium loti 62
5EDKTIKVGIMGGEDEDV2826.522/37gII 0960II 0338ABC transporter Mesorhizobium loti 64
6 EDVITLGASVQLSGPVANT4041.129II 1193II 0103Leu/Ile/Val Pyrobaculum aerophilum 30
7EVKDAVVGFLMPDQASTRYEERDYPGFAA3234.423II 0265II 0983 d-Galactose Streptococcus coelicolor 37
8QTELAWWHGMTGANNEM3944.625II 0655II 0625Glycerol-3-phosphate Streptococcus meliloti 88
9 EAVLNRGNDTD5056.321II 0538II 0734Oligopeptide Streptococcus meliloti 47
10VEISIAANSTGDNI4545.723II 0304II 0945Maltose Streptococcus meliloti 78
11RDQIQIAGSSTVLPYAKIV3434.924I 2138I 1989Phosphate Streptococcus meliloti 75
12 SEITIKLPDSV1410.417/25I 0440I 1494Hypothetical A. tumefaciens 46
13 EDAMKTDHMKPDA139.827II 0020II 0073Hypothetical A. tumefaciens 50
  • a Amino acids in italics, questionable after microsequencing data, were deduced from the TIGR B. suis genome.

  • b Experimental (Exp.) or theoretical (Th.) molecular mass in kilodaltons.

  • c Amino- acid number of the putative signal sequence.

  • d The amino acid identity between B. suis and B. melitensis ranged from 99 to 100%, except for Nop (protein 4) (50%), Rib (protein 3) (97%), and the repeat-containing protein 13 (88%). The roman numerical I or II before the gene number refers to the large or small chromosome, respectively. (In the B. suis genome, the gene numbers of the large and small chromosomes are normally preceded by BR or BRA, respectively).

  • e Putative function or substrate of the binding protein.

  • f Best identity with homologues of other bacteria after tBLASTN search.

  • g Since the first methionine is 37 amino acids upstream of the N terminus of the mature protein, CTG might also be an initiation codon, which would then lead to a 22-amino-acid-long signal sequence.