TABLE 3.

Comparative analysis of the loop 5 and alpha 5 epitopes at the inter- and intratype levels

OspC typeLoop 5 epitopeAlpha 5 epitope(s)
Sequence (amino acids 136 to 150)No. of sequencesSequence (amino acids 168 to 203)No. of sequences
A NKLKEKHTD-LGKEG--V 53 KGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVV 42
.........-...R.--. 3 ................................N... 1
.........SF....--. 1
B TKLKDNHAQLG-IQG--V 24 KGVEELEKLSGSLESLSKAAKEMLANSVKELTSPVV 17
......Q..R.-...--. 1
C KKLKEKHTDLG-KKD--A 4 KGAAELEKLFESVENLAKAAKEMLSNSVKELTSPVV 3
D KKLSDNQAELG-IEN--A 7 KGAEELVKLSESVAGLLKAAQAILANSVKELTSPVV 5
E NKLKSEHAVLG-LDN--L 13 KGAAELEKLFKAVENLSKAAQDTLKNAVKELTSPIV 13
F NKLKNGNAQLG-LAA--A 11 KGAKELKDLSDSVESLVKAAQVMLTNSVKELTSPVV 9
G KKLADSNADLGVAAG-NA 5 KGGKELKELSEAVKSLLKAAQAALANSVQELTSPVV 3
H GKLKNEHASLG-KKD--A 7 KGAKELKDLSDSVESLVKAAKEMLTNSVKELTSPVV 3
I AKLKGEHTDLG-KEG--V 12 KGADELEKLFESVKNLSKAAKEMLTNSVKELTSPVV 9
J KKLKDSRAELG-KKD--A 2 KGAKELKELFEAVESLSKAAKEML 3
......H....-...--. 1
K KKLEGEHAQLG-IEN--V 20 KGAAELEKLFKAVENLAKAAKEMLANSVKELTSPIV 12
N..........-T..--. 3 ................P................... 6
......A.........PQ.................. 3
L DKLKSENVALG-KQD--A 7 KGAKELKELSESVETLLKAAKEMLANSVKELTSPVV 10
.......A.......--. 3
M DKLKSSHAELG-IANGAA 5 KGAQELEKLFESVKNLSKAAQETLNNSVKELTSPVV 4
N KKLQSSHAQLG-VAGGAT 8 KGADELEKLFKSVESLAKAAQDALANSVNELTSPVV 7
...KD..QE..-..N..A 2 ...E.......A....S.....M.T...K....... 2
......G...E.........KEM.....K....... 1
O TKLKSSNAQLN-QAN--A 3 KGAEELVKLAESVAGLFKVAQEMLNNSVKELTSPVV 3
P NKLKNSHAELGVAGNGAT 6 KGAKELKELFESVESLAKAAKESLTNSVKELTSPVV 3
.......V.......... 1 ......................A.S............ 3
.............N.... 1 ................L...Q.A.........T... 1
Q DKLKNEHASLG-KKD--A 4 KGADELIKLSGSLESLSKAAQAILANSVKELTSPVV 1
R NKLKTSHAQLG-AANGGA 4 KGVTELEELFKSVEGLAKAAKEASANSVKELTSPVV 4
....N...E..V...... 3 ................P................... 2
S KKLKDNNAQLG-IQN--V 5 KGAKELKELFESVESLAKAAQAALANSVQELTNPVV 5
......H..F.-...--. 2
T NKLKSGHAELG-PVGGNA 3 KGAKELKDLSESVEALAKAAQAMLTNSVKELTSPVV 3
U KKLSESHADIG-IQA--A 3 KGAEELDKLFKAVENLSKAAKEMLANSVKELTSPVV 1