TABLE 3.

Comparative analysis of the loop 5 and alpha 5 epitopes at the inter- and intratype levels

OspC typeLoop 5 epitopeAlpha 5 epitope(s)
Sequence (amino acids 136 to 150)No. of sequencesSequence (amino acids 168 to 203)No. of sequences
ANKLKEKHTD-LGKEG--V53KGAEELGKLFESVEVLSKAAKEMLANSVKELTSPVV42
.........-...R.--.3................................N...1
.........SF....--.1
BTKLKDNHAQLG-IQG--V24KGVEELEKLSGSLESLSKAAKEMLANSVKELTSPVV17
......Q..R.-...--.1
CKKLKEKHTDLG-KKD--A4KGAAELEKLFESVENLAKAAKEMLSNSVKELTSPVV3
DKKLSDNQAELG-IEN--A7KGAEELVKLSESVAGLLKAAQAILANSVKELTSPVV5
ENKLKSEHAVLG-LDN--L13KGAAELEKLFKAVENLSKAAQDTLKNAVKELTSPIV13
FNKLKNGNAQLG-LAA--A11KGAKELKDLSDSVESLVKAAQVMLTNSVKELTSPVV9
GKKLADSNADLGVAAG-NA5KGGKELKELSEAVKSLLKAAQAALANSVQELTSPVV3
HGKLKNEHASLG-KKD--A7KGAKELKDLSDSVESLVKAAKEMLTNSVKELTSPVV3
IAKLKGEHTDLG-KEG--V12KGADELEKLFESVKNLSKAAKEMLTNSVKELTSPVV9
JKKLKDSRAELG-KKD--A2KGAKELKELFEAVESLSKAAKEML3
......H....-...--.1
KKKLEGEHAQLG-IEN--V20KGAAELEKLFKAVENLAKAAKEMLANSVKELTSPIV12
N..........-T..--.3................P...................6
......A.........PQ..................3
LDKLKSENVALG-KQD--A7KGAKELKELSESVETLLKAAKEMLANSVKELTSPVV10
.......A.......--.3
MDKLKSSHAELG-IANGAA5KGAQELEKLFESVKNLSKAAQETLNNSVKELTSPVV4
NKKLQSSHAQLG-VAGGAT8KGADELEKLFKSVESLAKAAQDALANSVNELTSPVV7
...KD..QE..-..N..A2...E.......A....S.....M.T...K.......2
......G...E.........KEM.....K.......1
OTKLKSSNAQLN-QAN--A3KGAEELVKLAESVAGLFKVAQEMLNNSVKELTSPVV3
PNKLKNSHAELGVAGNGAT6KGAKELKELFESVESLAKAAKESLTNSVKELTSPVV3
.......V..........1......................A.S............3
.............N....1................L...Q.A.........T...1
QDKLKNEHASLG-KKD--A4KGADELIKLSGSLESLSKAAQAILANSVKELTSPVV1
RNKLKTSHAQLG-AANGGA4KGVTELEELFKSVEGLAKAAKEASANSVKELTSPVV4
....N...E..V......3................P...................2
SKKLKDNNAQLG-IQN--V5KGAKELKELFESVESLAKAAQAALANSVQELTNPVV5
......H..F.-...--.2
TNKLKSGHAELG-PVGGNA3KGAKELKDLSESVEALAKAAQAMLTNSVKELTSPVV3
UKKLSESHADIG-IQA--A3KGAEELDKLFKAVENLSKAAKEMLANSVKELTSPVV1