Table 1.

Alignment of four variable regions of OMP P1 from 42 phylogenically diverse typeable H. influenzae and NTHI isolatesa

P1 typebStrainSequence of variable regionc:SdLoce
IIIIIIIV
85 107198      232281296427440
1BCH-1 DSYAIISDS---IKVTNDGSASA LIADTVKDN-QVKNTLTVQQEPLKFIDKYLPSKDT LEANVIKASKTGDLTL KTIGDKRSLALSTT NTUSA
BCH-3 DSYAIISDS---MKVTNDGSASA LIADTVKDN-QVKNTLTVQQEPLKFIDKYLPSKDT LEANVIKASKTGDLTL KTIGDKRSLALSTT NTUSA
3-H-1552 DSYAIISDS---IKVTNDGSASA LIADTVKDN-QVKNTLTVQQEPLKYINKYLPSKDT LEANVINASKTGDLTL KTIGDKRSLALSTT NTUSA
17-H-783 DSYAIISNS---IKVTNDGSASA LIADTVKDS-QVKTTLIVQQEPLKSIDKYLPSKDT LEAEAIKAGKKGXLTL KTIGDARSLALNTT NTUSA
21-H-1328 NSYAIISNS---IKVTNDGSASA LIADTVKDS-QVKTTLIVQQEPLKSIDKYLPSKDT LEAEAIKAGKKGDLTL KTIGDARSLALNTT NTUSA
27-H-1433 DSYAIISNS---IKVTNDGSASA LIADTVKDS-QVKNALIVQQEPLKSIDKYLPSKDT LEAXAIKAGKKGDLTL KTIGDARSLALNTT NTUSA
2200 NSDAIITSTSSGVKTIKHGSASQ IIVDSLKDN-QVQTALSVQKEPLKYLHKYLPSKDT VEADVIKAGKKGDLTL KTIGDERSLALNTT NTFinland
218 NSDAIITSTSSGVKTIKHGSASQ IIVDSLKDN-QVQTALSVQKEPLKYLHKYLPSKDT VEADVIKAGKKGDLTL KTIGDERSLALNTT NTFinland
667 NSDAIITSTNSGVKTIKHGSASQ IIVDSLKDN-QVQTALSVQKEPLKYLHKYLPSKDT VEADVIKAGKKGDLTL KTIGDERSLALNTT NTFinland
199 NSDAIITSTSNGVKTIKHGSASQ IIVDSLKDN-QVQTALSVQKEPLKYLHKYLPSKDT VEADVIKAGKKGDLTL KTIGDERSLALNTT NTFinland
37416 DSSAIISNM---IKATKDGSASE IIADSVKDN-QVKTALTVQQEPLKFLDKYLPSKDT VEANVIKAGKKGDLTL KTIGDERSLTLNTT aKenya
Rd TSHATIITSSSGIKAIEGGSASA IIADSVKDN-QVKTALTVQQEPLKFLDKYLPSKDT VEANVIKAGKKGDLTL KTIGDERSLTLNTT dUSA
47004 T--ASIATTK--MNSAKYGSASE IIANSVNDT-QVKTALSVLAPPLKGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRTLTLNTT bHolland
6094 T--ASIATTK--MNSAKYGSASE IIANSVNDT-QVKTALSVLAPPLKGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRTLTLNTT bUK
6107 T--ASIATTK--MNSAKYGSASE IIANSVNDT-QVKTALSVLAPPLKGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRTLTLNTT bUK
7109 T--ASIATTK--MNSAKYGSASE IIANSVNDT-QVKTALSVLAPPLKGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRTLTLNTT NTSweden
ATCC9795 T--ASIATTK--MNSAKYGSASE IIANSVNDT-QVKTALSVLAPPLRGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRTLTLNTT b
161 T--ASIATTR--MNSAKYGSASE IIANSVNDT-QVQTALSVLAPPLKGLDQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRALTLNTT NTFinland
OT-9 T--ASIATTK--MNSAKYGSASE IIANSVKDT-QVKTALSVLAPPRTALPQNLPSKDK VEANVIKEGKKGNLTL KTIGDKRALTLNTT NTCanada
51363 NSYATITSASSGVRTIKHGSASQ IIVETI-DN-QVNTALSALQEPFRDLKKHLPSKDK LEANVIKAGKKGDLTF KTIGEPRALTFNTT NTFinland
OT-81 NSYATITSASSGVRTIKHGSASQ IIVETI-DN-QVNTALSALQEPFRDLKKHLPSKDK LEANVIKAGKKGDLTF KTIGEPRALTFNTT NTCanada
69-H-1194 TSHATIVTSSSGVRAIKDGSASA ILAESVNDDDQVKGALLTLSEPFKNLNTHLPSKDK LEANVIKAGKKADLTF KTIGEQRSLTFDTT NTCanada
7MinnA TSYAQIITNQIGMKAIKDGSASQ LIADSVKDN-QITSALSTQQEPFRDLKKYLPSKDK LEANVIKEGKKGNLTF KTIGDKRTLTLNTT bUSA
81071 ASSVIISNM---VKATQDGSASA TISDSVNDS-QLTGVLSTLAKPFKELNKHLPSKDK LEAGVIGAGKTGNLTL KTIADKSGLPLTST NTFinland
9BCH-2 ASSAIVNSA---MKATKEGSASQ IIVDTVNDD-QVKRGLTVLQPPYKTLDKYLTSKDK LEAGVIGAGKTGNLTF KTIGEKSGLPVTAT NTUSA
10LO-127 PSSVTTNST---MKTTMDGSASE VIVDIVNDT-QIKXALAALSEPYKDFPNYLTSKDK VEANVIKAGKKGDLTL NTIGKESGLPLTTT NTCanada
115 TSSA--TPANSVMTAIRYGSASA IIEGTVNDD-QIKRALTTQPKPYKDFPQHLSSKDK LEAGVIGAGKKGDLTL KAIGEKRSLTFDTT NTUSA
121512A SVSASITGAS--VKITRNGSASQ LIADTVNDN-QIKQALSTQQTTLRDLPKHLTSKDK LEAEAIKAGKKGDLTL KAISQA-TLTLDTT NTUSA
49 DVRASITGVS--VKTTKNGSASQ IIANTVNDN-QVKLPLSTQPETLRDLHKHLPSKDK LEAEAIKAGKKGDLTL KAITKS-VLTLDTT NTUSA
131-H-1085 KCYASITGIS--VKTTKNGSASA LIVDSV-EIARNGQAFTVLGEPLKTIGQYLTSKDK LGAGVIKAGKKGDLTL ETISQA-QLTLNTT NTUSA
146181 E--AFIATLK--MKTTKNGSASE IIADTV-KISQG--AFTVGSQEDKAIPKYLTSKDK LEAGAIGAGKKGDLTL ATIG--KSVILNTT eUK
1522-H-1154 DSYAIISNS---IKVTNDGSASA IIKESV-ELAKT--AFTVAQDDEKAIPTYLTSKNT LEAEAIKAGKKGDLTL KTIGDARSLALNTT NTUSA
164-H-1094 K--SSTKNLQ--MLAAKYGSASQ IIKESV-ELAKT--AFTVAQDDEKAIPTYLTSKNT LEAGVIGAGKKGDLTL KTTG--KTVILNAT NTUSA
176255 D--SSITATT--MRTTKYGSASA IIAESVKI-AQN--AIKTVNPKDK-ATDYLTSKDK LEAEVIEAGKKGNLTL QKAVGGF---ITTT NTUK
ATCC9833 D--SSITATT--MRTTKYGSASA IIAESVKI-AQN--AIKTVNPKDK-ATDYLTSKDK LEAEVIEAGKKGNLTL QKAVGGF---ITTT f
C-105 N--SSITATT--MRTTKYGSASA IIAESVKI-AQN--AIKTVNPKDK-ATDYLTSKDK LEAEVIEAGKKGNLTL QKAVGGF---IXTT NTCanada
182-H-1038 A--ASITGSS--IKVTNDDVASE IIADSVKD-PQAKRALETVVPGTK-IPDYLTSKDK LGKKGIEAGKTGNLTF QKVADDF---ITAN NTUSA
19658 L--SSITSAS--MKTTKYGSASE IIVRSVKD-SQAQTALKTVVPGTL-IPDLLTSKDK LGQKSIEAGKTDNLTL QKVADGL---ITTN NTFinland
2013-H-1157 D--AYLQSGS--MKFTKYGSASQ IIADSVQD-SQVKPALQAVDPQNK-ATGYLTSKDK LEAGAIKAGKKGDLTL QKAAGGH---IITT NTUSA
219 N--ASIKAT---MNMTKYGSASQ LIADTVQD-QQIQKALKAVDSKTV-IPDYVTSKDK LEAGVIGAGKKGDLTL QQV-GGH---IITN NTUSA
227424 A--ASIKATA--MGRTKYGSASA IIADSIQD-NQIQQALKAVDPQTK-LHNYLTSKDK LGAKDIVAGKTGDLTF QQA-GGH---IITT NTKenya
234-H-1093 D--ASIKATA--MARTKYGSASQ IIADSIQD-NQIQQALKAVDPQTK-IHEYLTSKDK LGKKDIVAGKTGDLTL KTI-GAH---IITN NTUSA
  • a Alignment is based on data from references 47 and 61 and this study. Putative surface-exposed loops of OMP P1 correlating with variable regions I to IV are loops 2, 4, 5, and 8, respectively (13, 14, 47).

  • b Isolates with the same P1 type have OMP P1 amino acid sequences of ≥95% similarity.

  • c Numbers indicate amino acid positions at the beginning and end of a variable region. Dashes, gaps inserted to optimize alignment.

  • d S, H. influenzae serotype. NT, nontypeable.

  • e Loc, country of strain isolation. USA, United States; UK, United Kingdom.